KEGG   Pteropus alecto (black flying fox): 102893141Help
Entry
102893141         CDS       T02993                                 

Gene name
TMPRSS15
Definition
(RefSeq) LOW QUALITY PROTEIN: enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102893141 (TMPRSS15)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     102893141 (TMPRSS15)
Peptidases and inhibitors [BR:pale01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102893141 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM SEA Ldl_recept_a DUF1986 SRCR SRCR_2
Motif
Other DBs
NCBI-GeneID: 102893141
NCBI-ProteinID: XP_006908345
Position
Unknown
AA seq 1021 aa AA seqDB search
MVAKKSVPSRHHSLSIYEVVFVALFVILVLVCAALIALSWLAIRGSERDAAFGKSHETRG
TFKITSGATYNPNLQDKLSVDFKVLAFDLQEMIDEIFQSSNLKNEYKNSRVLRFENGSII
VIFDLFFAQWVSDENVKEELIQGIEANKSSQLVTFHIDLNSIDITGTLTTSSHLVTPRNV
SIKCQPGSRPCADAIKCIATDLFCDGELNCPDGSDEDSKTCATACDGRFLLTGSSGSFDA
TYYPKPSKSSIVCQWIIRVNQGLSIQLSFNSFNTYYTDILNIYEGVGSSKILRASLWETN
PGIIRIFSNEVTATFLIESNEDDYTGFHATYTTFNSTELSNYEKINCNFEDGFCFWXQDL
XXXXXXXXXXXVQGNTFPPLTGPDFDHTFGNISGFYISTPTGPGGRQERVQLLSLPLDPT
LEPVCLSFWYYMYGENVYKLSINISNDQNMEKIIFQKEGNYGKNWNYGQVTINETVEFKV
AFNAFKNRLLSDIALDDISLTDGICNVSLYPEPTLVPTPPPESPTDCGGPFELWEPNTTF
TSMNFPNNYPNQAFCVWNLNAQKGKNIQLHFQEFDLENIADVVEIRDGQEDDSLLLAVYT
GPGPVKDVFSTSNRMTVLFITNKELTKGGFKANFTTGYHLGIPEPCEEDYFQCKNGECVP
LINLCDSLPHCKDGSDEAHCVRLSNGTTNTGLVQFRIQSIWHVACAENWTTQISNDVCQL
LGLGSGNSSMPVFSTGGGPFVKLNTAPNGSLILTPSEQCLQDSLILLQCNHKSCGKKLVA
QKVSPKIIGGNNAKEGAWPWITALYYDDQLLCGASLVSNDWLVSAAHCVYGRNLEPSKWK
AILGLHMTSNLTSPHVVTRLIDQIVINPHYNKRMKDNDIAMMHLEFKVNYTDYIQPICLP
EENQLFPAGKICSIAGWGSVVYQGPTVNILQDADVPLLSNEKCQQQMPEYNITKNMVCAG
YEEGGIDSCQGDSGGPLMCQENNRWLLVGVTSFGYQCALPNRPGVYAWVPGFTEWIQSFL
R
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaaaaaaagtgtaccttcaagacaccattctctcagcatctatgaagttgtg
tttgtggctctctttgttattttggtgctagtctgtgctgcattaattgcactgtcctgg
ctggcaatcaggggatcagaaagagatgcagcatttggaaaaagtcatgaaaccagaggg
acttttaaaataacatcgggagctacgtataatcctaatttgcaagacaaactctcagta
gatttcaaagttcttgcttttgaccttcaagaaatgatagatgagatctttcaatcaagt
aacctcaaaaatgaatataaaaactcaagagttttacgatttgaaaacggcagcattata
gtcatatttgaccttttctttgcccagtgggtgtcagatgaaaacgtaaaagaagaattg
attcaaggcattgaagcaaataaatccagccaactggtcactttccatattgatttgaac
agcattgatatcacaggtaccttgacaaccagcagtcatctggtaaccccaagaaatgtc
tcaatcaagtgccagcctggttcaaggccttgtgctgatgccataaaatgcatagcaact
gatttattttgtgatggagaattaaactgtccagatggttctgatgaggacagtaaaact
tgtgccacagcttgtgatggaaggtttttgctgactggatcttcagggtctttcgatgct
acctattacccaaagccttctaaatcaagtattgtttgccaatggattatacgtgtaaac
caaggactttccattcaactgagcttcaattcctttaatacatattatacagacatatta
aatatttatgaaggtgtgggttcaagcaagattttaagagcttctctctgggaaactaat
cctggtataattaggattttttccaacgaagttactgctacctttcttatagaatctaat
gaagatgattatactggctttcatgcaacatatactacatttaatagcacagaacttagt
aattatgagaaaattaactgtaattttgaagatggtttttgcttctggnnccaggatcta
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnagttcagggaaatacctttcctcctctt
actggaccagattttgaccacacttttgggaatatttcaggattttacatttccacccca
actggaccaggagggagacaagaaagagtacagcttttaagtctccccctagaccccact
ttggaaccagtctgccttagtttctggtactacatgtatggtgaaaatgtctataaatta
agcattaacatcagcaatgaccaaaacatggagaagataatttttcaaaaagaaggaaat
tatggaaaaaattggaattatggacaagtaacaataaatgaaacagtagaatttaaggtt
gcttttaatgcttttaaaaatcggctcctgagtgatatagcattggatgacattagctta
acagatgggatttgcaatgtgagtctttatccagaaccaactttggtcccaactcctcca
ccagaaagtcctacggactgtggaggaccttttgaactgtgggagccaaatacaactttc
acttctatgaattttccaaacaactatcctaatcaggctttctgtgtttggaatttaaat
gcacaaaagggaaagaacatacaacttcattttcaagaatttgacttagaaaatattgca
gatgtagttgaaatccgagatggtcaagaagatgattccttgctcttagctgtgtataca
ggacctggtcctgtaaaggacgtattctcaacctccaacagaatgactgtgcttttcatc
accaacaaggaattgacaaaaggaggatttaaagccaactttactactggctatcactta
ggaattccagaaccctgtgaagaagattattttcagtgtaagaatggagagtgtgttccg
ctaatcaacctctgtgacagtcttccacactgtaaggatggctcggatgaagcgcattgt
gtgcgtctttccaatggcaccacgaacactggtttggtacagttcagaattcagagcata
tggcatgtagcgtgtgctgagaactggacaacccagatttcaaatgatgtttgtcagctg
ctgggactggggagtggaaactcatcaatgccagtcttctctactggaggtggaccattt
gtaaaattaaacacagcacctaatggcagcttaatactaacaccaagtgagcagtgttta
caagattccctgattctgttacaatgtaatcacaaatcatgtggaaaaaaattagtggct
caaaaagtcagcccaaagattattggaggaaataacgccaaggaaggagcctggccctgg
atcactgctctgtattatgacgaccaactgctctgtggagcttctctcgtcagcaacgac
tggctggtgtctgccgcccactgtgtgtatgggagaaatttagagccatctaagtggaaa
gcgatcctaggcctgcatatgacatcgaatctcacttctcctcatgtagtaacccggttg
atagaccaaatcgtcataaatccacattacaacaaacggatgaaggacaatgacattgcc
atgatgcatcttgaatttaaagtgaattacacagattatatacaacctatttgcttacca
gaagaaaatcagctttttcctgcaggcaaaatttgttctattgctggctgggggagtgtt
gtatatcaaggtcccactgtaaacatattgcaagatgctgatgttcctcttctatcaaat
gagaaatgccaacagcagatgccagaatacaatattacaaaaaatatggtgtgtgcaggc
tacgaagaaggaggaatagattcttgtcagggggattcaggaggaccgctaatgtgccaa
gaaaacaacaggtggctcctggttggtgtgacatcattcggataccagtgtgcactgcct
aatcgcccaggggtgtatgcctgggtgcctgggttcacagaatggatacaaagctttctc
cgttag

DBGET integrated database retrieval system