KEGG   Pteropus alecto (black flying fox): 102894158
Entry
102894158         CDS       T02993                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pale03021]
    102894158 (AFF3)
Transcription machinery [BR:pale03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102894158 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int Sod_Cu
Other DBs
NCBI-GeneID: 102894158
NCBI-ProteinID: XP_015448200
Position
Unknown
AA seq 1306 aa
MIALTNNLVTITTVTTTIIITLTIFTTATTLITTITTFITISTPTTLTTTSTMTTTVQAM
RDSSWGDPCLFTKLQGEDILNQRNDSLVLEFQSSASRCRSVYEPDRNVLRRKERERRNQE
TQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKP
GLPQAAVNKLDEHFVADSRAQPQPSSVCSTAPSTPAAVPVPQSKRGTMGWQKAGHPPPDG
QQRATQQGSLRTLLGDGVGRQQPRAKQVCNIEVGLQTQERPPAMAAKHSGSGHCVQNFPP
SLASKPSLVQQKPTAYVRPMDGQDQAPDQSPKLKSSTEANVHCTSYRGVPATKPESARAK
GKLPKFSVPKQVEESRSGETNSCVEEIIREMTWLPPLSAIQAPGKVESSKFSFPNKDSQL
VSSGHSNPKKSDAETESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTTLHALSDSAVV
QQANCRASVPSSKGSSSGSSSSGSSSSSDSESSSGSDSDTESSSSESEGSKPAHYPSPEA
EPASSNKWQLDKWLNKVNPHKPPILIQNESHEPEGSQYYAPGKDQVQDCTKLPDGCQAVL
REKDIKSTCKEEQRPRTANKAPGAKGVKQKSPPAAVAVAVTTTAPPPAVPGAPPDNTPAR
RSAGKKPPRRTERTLASDSANCHRPEEPADALGTGVVIPPEPTKARPCSNSRTGHRKELR
ASASVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEVYPLAKAQAVAATA
SASDQRLKEAAGSISGGGGPRAPVGSINARTTNDIAKELEEQFYTLVPFGRNELLSPLKD
SDEVRSLWVKIDLTLLSRIPEHLPRLPGVLSAPATKDADSAPPSQPSDTPAEKALPKSKR
KRKCDNEDDYREMKKAQGEKDSSSRPTTSVSNALSANHCSMAINSLAIPINKNEKMLRSP
ISPLSDASKHKHSNEDLTSSSRSNGGGLFTSAPSNKKHKAENQLQPHSGELTKMVHNNSE
NAVHKSRPQTEPWSPGSNSHQDCKRQRLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGK
ALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQL
AALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTSSPM
SPSPSPTSSVGSQGGLPHANALSPSTIISIPQRIHQMAANHVSITNSILHSYDYWEMADN
LAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3921 nt   +upstreamnt  +downstreamnt
atgatagcgctcaccaacaaccttgtcaccatcaccactgtaaccactactatcatcatc
accctcaccatcttcaccacagccaccacccttatcaccaccatcaccaccttcatcacc
atctccacccccactactctcaccaccaccagcaccatgactacaacagtacaggccatg
agggactccagttggggggatccttgcctctttaccaagctccagggtgaagacatctta
aaccagaggaatgactctctagtgctggagtttcagtcatcagccagccgatgtaggagt
gtctatgaaccagatagaaatgtgttacggaggaaagaacgagaaagaagaaatcaggaa
actcagcaggatgatggcacatttaattccagttattccctcttcagtgaaccctacaag
actaacaagggggatgagctctccaaccggatccagaacactttaggcaattatgatgaa
atgaaagactttttaactgatagatccaatcagagtcatctcgttggtgttcccaaaccg
gggctccctcaggccgctgtgaacaagcttgatgagcattttgttgcagattcacgagcc
cagccccagccctcgtctgtctgcagcactgcaccctccacaccagcagccgtccccgtg
ccgcagagtaagaggggcaccatgggctggcagaaggctgggcacccgcctcccgacggc
cagcagagagcaacacagcagggctctctcaggaccttgctcggcgatggtgttggcaga
cagcaaccacgggccaaacaagtgtgcaacatagaggtgggtcttcagacccaggaaagg
ccccctgcaatggcagccaagcacagcggcagtggacactgtgttcagaactttcctcca
tccctggcttcaaaacccagcctggtccagcagaagccgactgcatacgtgcggccaatg
gatggccaggatcaggctcctgatcagtctccgaagcttaagtcatccacagaagccaac
gtgcactgcacatcgtacagaggagtcccggccaccaagccagagtcggccagagcaaag
ggcaagcttcccaagttcagcgtccccaaacaggtggaggagagtagatctggagaaacc
aacagctgtgtggaagagatcatcagggagatgacctggcttccaccactttctgctatt
caagcacctggcaaagtggaatccagcaaattttcatttccaaataaggactctcagctc
gtttcctctggacacagtaatccaaagaaaagtgatgctgagacagagagtccagacaat
ggcacctcaaatacatcaatgctagaagatgaccttaagctaagtagtgatgaagaggag
aatgaacagcaggcagcgcagagaaccactctccacgctctgtctgacagcgccgtggtc
cagcaggccaactgcagagcctcagtgccttccagcaagggcagcagcagcggcagcagc
agcagcggcagcagttcatccagtgactcggagagcagctccggatccgactcggacacc
gagagcagctctagcgagagtgagggcagcaagcctgcccactaccccagccccgaggct
gagccggcgtcctctaacaagtggcagctggataaatggctgaacaaagttaatccccac
aagccgcctatcctgatacaaaatgagagccacgagccggagggcagccagtactacgcc
ccagggaaagaccaagtgcaggactgcacgaagctcccagatgggtgccaggccgtcctg
agagagaaggacatcaagagcacttgcaaggaggagcagaggccaaggacagcaaacaag
gcgccaggggccaagggggtgaagcagaagtccccgcccgcggccgtggcagtggctgta
accacaactgccccgccacctgcagtccccggcgcaccccccgacaacacgcctgctcgc
aggtctgcaggcaagaagccgcctaggcgcacggagaggaccttagccagcgacagcgcc
aactgccaccggcctgaggagcccgccgacgccctggggacaggtgtggtgatcccccca
gagcccaccaaagccaggccctgcagcaacagcagaacaggccaccgcaaggagctacgg
gcctctgcctctgtcacctgtgagaagcgccgcacacgggggctgagcagaattgttccc
aagtccaaggagttcatcgagacagagtcatcatcttcgtcctcctcctcggactcagac
ctggagtcagagcaggaggtgtaccctctggccaaagcacaggcggtggctgctacagcc
tctgcaagtgaccagaggctcaaggaggctgccggcagcatcagcggaggcggtggcccc
cgtgcaccggtgggctccatcaacgccaggaccaccaatgacattgccaaggagctggag
gagcagttctacacactggtccccttcggccgcaatgaactactctccccactgaaggac
agtgatgaggtcaggtccctatgggttaaaatcgacctgacccttctgtccaggatccca
gaacacttgccccggttgccgggggtcttgagtgctcctgccaccaaggacgccgatagt
gcacctcccagccagccatccgacacacctgccgaaaaggctttgccaaaatccaagagg
aaacgcaagtgtgacaatgaagacgactacagggagatgaagaaggcccagggggaaaag
gacagctcatcacgaccaaccacctctgtcagtaatgctttgtctgcgaaccattgcagc
atggccatcaacagcttggcaatacccataaataaaaatgaaaaaatgctccggtcgccg
atctcacccctctctgatgcctctaaacacaaacactccaacgaggacctgacgtcttcc
agcaggtccaatggtggcggtttgttcacttctgccccctccaacaaaaagcacaaggcc
gagaaccagctgcagcctcacagcggagaactcacgaaaatggttcacaacaattcggaa
aatgctgtccataagtcacggccacagacagagccatggtctcctggctccaacagccac
caggactgcaagaggcagagacttgtcttcgacgatatgccgcgtagtgcagattatttt
atgcaagaagccaaacggatgaagcataaagcagatgcaatggtggaaaagtttgggaag
gctttgaactacgccgaggcggccttgtcattcatcgagtgtggaaatgcgatggagcag
ggcccgatggaatccaaatccccttacacgatgtactcggaaacagtggagctcatcagg
tatgccatgagactaaaaacccactcaggccccaatgccacaccagaggataaacagctg
gctgcgttgtgttaccgatgcctcgctctcctttactggcggatgtttcgactcaaaagg
gatcatgctgtgaagtattcgaaagcacttatcgactatttcaagaattcatctaaagca
gcccaagccccatctccatggggggccagtggaaagagcacagggacctcatcccccatg
tcgcccagcccctccccaaccagctccgtgggatctcaggggggcctcccccatgccaat
gccttgtccccttcgaccatcatcagcatcccacagcgcatccaccagatggccgccaat
cacgtcagcatcaccaacagcattctccacagctacgactactgggagatggcggacaac
ctggccaaggagaacagagaattcttcaatgacctggatcttctcatggggcctgtaacc
ctccacagcagcatggagcacctggtccagtactcccagcaaggcctgcactggctgagg
aacagcacccacctatcatag

DBGET integrated database retrieval system