KEGG   Pteropus alecto (black flying fox): 102894573Help
Entry
102894573         CDS       T02993                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04260  Cardiac muscle contraction
pale04261  Adrenergic signaling in cardiomyocytes
pale04921  Oxytocin signaling pathway
pale05410  Hypertrophic cardiomyopathy (HCM)
pale05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pale05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102894573 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102894573 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102894573 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    102894573 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102894573 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102894573 (CACNG3)
   05414 Dilated cardiomyopathy (DCM)
    102894573 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pale04040]
    102894573 (CACNG3)
Ion channels [BR:pale04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102894573 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 102894573
NCBI-ProteinID: XP_006912580
Position
Unknown
AA seq 315 aa AA seqDB search
MRMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTGDNETSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVTLLFFGGL
CVAASELHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPVSKGFHAIPSTDISMFTLSRDPSKITMGTLLNSERDHTFLQFHNSTPKELK
ESLHNDPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacaggggtgtccagatgttgatcaccactgtgggggccttcgcagct
tttagcttgatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaggtgataatgaaaccagcaggaagaatgaagaagtcatgacccac
tcggggctgtggaggacctgctgcctagaagggactttccgaggggtgtgcaagaaaatc
gatcacttcccagaggatgccgactacgagcaggacacggccgagtatctcctccgggcg
gtgagggcctccagcatcttccccatcctcagcgtcacgctgctgttcttcggcgggctc
tgcgtggccgccagcgagctccaccgcagcaggcacaacgtcatcctcagcgcaggcatc
tttttcgtctccgcagggctcagcaacatcatcggcatcatagtctacatctcggccaac
gccggggaccccgggcagcgcgactccaagaagagctactcgtacggctggtccttctac
ttcggcgccttctccttcatcatcgcggagattgtcggcgtggtggccgtgcacatctac
atcgagaagcaccagcagctgcgcgccaggtcccactcggagctcctgaagaaatcgact
ttcgcccgcctccccccctacaggtacagattccggcggcggtcaagttcacgctccacg
gagcccaggtcccgggacctgtccccggtcagcaaaggcttccacgccatcccctccacc
gacatctcaatgttcacgctgtcccgggacccctcgaagatcaccatggggaccctcctc
aactctgagcgggaccacactttcctacagttccacaactccacgcccaaggagctcaag
gagtccctgcacaacgacccggccaacaggcgcacgacgcccgtctga

DBGET integrated database retrieval system