KEGG   Pteropus alecto (black flying fox): 102894906Help
Entry
102894906         CDS       T02993                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102894906 (THNSL2)
Enzymes [BR:pale01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     102894906 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 102894906
NCBI-ProteinID: XP_006914305
Position
Unknown
AA seq 484 aa AA seqDB search
MWYISTRGMAPRVDFEGALFSGYAPDGGLFMPEELPPLGRETLRQWSALSYPSLVKELCA
LFIGPELIPRDDLNDLIYQAFRRFRHREVVHLSRLKNGLNVLELWHGITYAFKDLSLCCT
AQFLQYFLEKREKHITVVVGTSGDTGSAAIESVQGAKNVDIIVLLPKGHCTKIQELQMTT
VLKENVRVFGVEGNSDELDEPIKAVFADVAFVKKHNLMSLNSINWSRILVQMAHHFFAYF
RCVPSLDMDPLPPVEVVVPTGAAGNLAAGCLAQKMGLPIRLVAAVNHNDIIHRTVERGDF
SLSKTVKPTLASAMDIQVPYNMERIFWLLSGSDSQVTRALMEQFERTQSVSLPEELRSKL
SAAVTSESVSDEAITQTMGRCWEENQYLLCPHSAVAVSYHYQQMDRQQPSPPRCCLAPAS
AAKFPEAVLAAGLTPQIPSEVSALEKKETRCTPMRKSDDWTLMLRDTIEDIGQQWRGHFP
NAPE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacatcagcacccgggggatggctccgcgggtcgactttgagggggccctcttc
tctggctatgctcctgatggaggcctcttcatgcccgaggagctcccaccactgggcaga
gagacgctgcgtcagtggagtgcactctcctacccaagcctggtgaaggagctgtgtgcc
ctcttcattggccctgagctcattccaagagatgacttaaacgatctgatctaccaagcc
ttccgcagattccgccatagagaggtggtccatctgtccaggctgaagaacgggctgaac
gtgttggagctgtggcatgggatcacgtatgcgtttaaggatctgtccctgtgctgcaca
gcacagttcctgcagtacttcctggagaaaagggagaagcacatcactgtggttgtggga
acttcaggggacacagggagtgctgccattgagagtgttcaaggggcaaagaatgtggac
atcatcgttctgctgcccaagggtcactgcacgaagattcaggagctccagatgacaacg
gtgctgaaggagaacgtccgtgtgtttggagtggagggaaacagcgatgagctcgatgag
ccaatcaaggccgtgtttgcggatgtggcttttgtcaagaagcacaatctgatgagtctg
aattcaatcaactggtctcggatcctcgtgcaaatggcccaccacttctttgcttatttc
cggtgtgttccatccttagatatggacccactgccccctgtggaggtggttgtgccaacg
ggggctgctggtaaccttgcagctgggtgccttgctcagaagatgggcctgcccatccgc
ctggtcgcagcagtgaaccacaacgacatcatccacaggactgtcgagcgaggagacttc
tctctgtctaagaccgtcaaaccaaccttggcatcagctatggacattcaggtgccctac
aacatggagaggatattctggctattatctggttctgacagccaggtgactagagccctc
atggagcagtttgaaaggacccaaagtgtgagtctacctgaggaacttcgaagcaagctt
tcagcagcagtgacgtctgagtcggtgtcagatgaggccatcacccagaccatgggccgc
tgctgggaagagaaccagtacctgctgtgccctcactcagctgtggccgtgagctaccat
taccagcagatggacaggcagcagcccagccctccccggtgttgcctggctcccgcctct
gcagccaagttcccagaagctgtcctggctgccgggctgaccccacagattccctcggag
gtatcagccctggagaagaaagagacacgctgtaccccaatgcggaagagtgatgactgg
accctgatgcttcgggacacaattgaggacataggccagcagtggaggggtcactttcca
aatgctccagaatag

DBGET integrated database retrieval system