KEGG   Pteropus alecto (black flying fox): 102896433Help
Entry
102896433         CDS       T02993                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00561  Glycerolipid metabolism
pale01100  Metabolic pathways
pale04714  Thermogenesis
pale04723  Retrograde endocannabinoid signaling
pale04923  Regulation of lipolysis in adipocytes
Module
pale_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102896433 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102896433 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102896433 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102896433 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pale01002]
    102896433 (MGLL)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102896433 (MGLL)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S33
   102896433 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Abhydrolase_5 Peptidase_S9 LIDHydrolase Thioesterase BAAT_C DUF1057 Abhydrolase_2 Chlorophyllase2 TMEM117
Motif
Other DBs
NCBI-GeneID: 102896433
NCBI-ProteinID: XP_006911506
Position
Unknown
AA seq 303 aa AA seqDB search
MPEESSPKRTPQNIRYQDLPHLVNADGQYLFCKYWKPAGTPKALVFVSHGAGEHCGRYDE
LAQMLVGLELLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDFVQKDYPGVPVFLLG
HSMGGAIAILTAAERPGHFSGMVLISPLVLASPESATTFKVLAAKVLNLVLPNMSLGPID
ASVLSRNKTEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTAAVRTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggaaagttctcccaagcggacaccgcagaacattaggtaccaggacctccct
cacttggtcaatgccgatggacagtacctcttctgcaaatactggaaacccgcaggcact
cccaaggccctcgtctttgtgtcccatggagccggggagcactgcggccgctatgatgag
ctggctcagatgctggtggggctggagctgctggtatttgcccatgaccacgttggccat
ggacagagtgaaggggagaggatggtggtgtctgacttccacgttttcatcagggatgtg
ttacagcatgtagattttgtgcaaaaagactacccaggagttcctgtcttccttctgggc
cactccatgggaggtgccatcgccatcctcacagctgcagagaggccaggccacttctct
ggcatggttctcatttcacctttggttcttgccagtcctgagtctgcaacaactttcaag
gtccttgctgcaaaagttctcaaccttgtcctgccaaacatgtccctgggcccaatcgac
gccagtgtgctctctcggaataagacagaggttgacctttataacacggacccccttatt
tgtcgggctggactgaaagtgtgctttggaatccagctgctcaatgctgtctcgcgagtg
gaacgggcactccccaagctgactttgcccttcctgctgctccagggttctgctgaccgc
ctgtgcgacagcaaaggggcctacttacttatggagtctgccaagagccaggacaagaca
ctcaagatttacgaaggtgcctaccatgttctccacaaagagcttcctgaagtaaccaac
tctgtcttccatgaaataaacatgtgggtctctcaaaggacagcagcagtgagaacaggg
tctccaccctga

DBGET integrated database retrieval system