KEGG   Pteropus alecto (black flying fox): 102896809
Entry
102896809         CDS       T02993                                 

Gene name
AHRR
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102896809 (AHRR)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102896809 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4
Other DBs
NCBI-GeneID: 102896809
NCBI-ProteinID: XP_024906278
Position
Unknown
AA seq 771 aa
MRVSLDILTARKPEVTGELTSLGAQRRQAPVSGTAAGGGWRVRSAEPRAAVSEQSRPPGE
CMYAGRKRRKPVQKQKPATGAEKSNPSKRHRDRLNAELDHLASLLPFPADVVSKLDKLSV
LRLSVSYLRVKSFFQALQEQRPGLPVTRAPSPGGSGPRGPSAVLEGRLLLETLDGFALVV
SAEGVIFYASATIADHLGFHQTDVMHQNIYDYIHVDDRQHFRRQLHWAMDPPQAVGGQPL
RPDTGEDAVLGRLLRAQAGAAGPTEFAAFLTRCFTCRVRCLLDSTSGFLAGRLGGGPRYG
LGAPSSSQAQGHEGGTHGLHGLLARLCRVPSGRMRCLLAYVYPRFRAQGLLQLLRDKPER
SSSAVLLLASAVGARNLHALLLPVLCRAKATRSLCESELHGKPSFLAGRSNGERGVSVLR
AQVDACHWARAPARATCLCLRGGPDLVLGPEGAAGDRAAGEHGRARRETHTYDCRFQTPE
PGRHLSWVTGKRGQDGARLKLEPSRGEPFPTHAAPRGSCLSSPGGLGTVPAFRNPPSCHQ
APSAFPSRASRALRDGGQGQAHPPASCPFPQGGLENRLPQPSVQRLAVGGYSTEDIKVRS
VPMPPGAPCNPMFSLNVPIKMESDSGSENAPDGYCMPPSQMXXXXXXXXXXXFPTRMHLK
TEPDSRHHLYSPHLGPGMLGAPPRPGRELTPGHPSLCVCLEPPPCLCMRGHQPPTLGRDC
RAPGTTSMVKREPLDSPPWAAHSQGGVHRMLPKSALATLMPPTASEGAFLP
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgcgtgtgagcctagacatcctcactgctcggaaacccgaagtgacgggcgagctgacc
agcctcggagcccagaggaggcaggcgcctgtgtccggcaccgccgccggcggaggctgg
cgggtgcggtcagctgagcccagagcagctgtgagtgagcagagtcgaccgccgggcgag
tgcatgtacgccgggcgcaaaaggaggaagccggtccagaaacagaagcccgccacgggg
gctgagaagtcgaacccttccaagcggcaccgagaccggctcaacgccgagctggaccac
ctggccagcctgctgcccttcccggccgatgtggtctccaagctggacaagctctcggtg
ctgcgtctcagcgtcagctacctccgcgtgaagagcttcttccaagccctgcaggagcag
cgcccagggctgccggtcaccagggcgccctcgccagggggcagcggccctcgcggacct
tcggctgtgctggagggacggctgctgctggagaccctcgacggcttcgccctggtcgtg
agtgcagaaggggtcatcttctacgcctcggccaccatcgcagaccacctgggcttccac
cagacggacgtgatgcaccagaacatctacgactacatccacgtggacgaccgccagcac
ttccgccggcagctgcactgggccatggacccgccgcaggccgtgggtgggcagcccctg
cgcccagacacaggagaggacgccgtgctggggaggctgctcagggcccaggctggcgcc
gcgggccccaccgagttcgcggccttcctgacccgctgcttcacctgccgtgtgcgctgc
ctgctggacagcacctcgggcttcctggctggccgcctgggcgggggcccgcgctatggc
ctgggagccccatcttcctcgcaggcgcagggacatgaaggtggcacccatggtctgcac
ggccttctcgcccggctgtgcagggttccatctgggcggatgcgctgcttgctagcttac
gtgtaccccagattcagggcccagggccttttgcagttactccgggacaagccagagcgc
agcagcagcgccgtcctgttgctggcttctgccgtcggcgcccgtaacctgcacgccctt
ttgctacctgttctttgcagagcgaaagctaccaggagtctgtgtgagtctgagttgcac
ggaaaacccagtttcttagcaggaaggagcaacggagagcgtggcgtctcggtgctccgg
gcacaagtggacgcctgccactgggcccgggctccagccagggccacgtgcctgtgcctg
cggggtggccccgacctcgtccttggccctgagggagccgcaggggacagggctgcaggg
gagcacggcagggcacggagagaaacgcacacgtatgactgccgcttccagacgccggag
cctgggaggcacctgagctgggtgacagggaaacgcggtcaggatggggccaggctgaag
ctagagcccagcaggggtgagccgttccccacacatgccgcaccccggggctcttgcctg
tcctcccccggtggcctgggcaccgtccctgccttcaggaacccccccagctgtcaccag
gcccccagcgccttccccagccgggccagcagagccttgcgggatggaggtcagggccag
gcgcaccctcccgccagctgccccttcccgcaggggggcctggagaaccggctccctcag
ccctctgtgcagcggctggcagtaggaggctattccactgaggacatcaaggtgcgaagt
gtgcccatgcccccaggagccccgtgcaaccccatgttttcactcaatgtgcccatcaag
atggagagtgactctgggtccgagaatgcaccagatggctactgtatgcccccaagtcag
atgnntnnnnnnnnnnnnnnnnnnnnnnnnnnnnntttccctaccaggatgcacctgaaa
acagagccagactccaggcaccacctgtacagcccacacctggggcctggcatgctgggg
gcgccccccagaccaggcagagaactcaccccgggccacccctcactttgcgtctgcctg
gagcctcctccctgcctctgtatgcggggccaccagcccccaactctgggccgtgactgc
agagctcccgggaccacatccatggtcaagcgtgagccactggactcacccccgtgggct
gctcacagtcagggcggggtgcacaggatgcttcccaaaagtgccttggcaacactgatg
ccgcccacagcctctgagggcgctttcctgccatag

DBGET integrated database retrieval system