KEGG   Pantoea alhagi: B1H58_00750Help
Entry
B1H58_00750       CDS       T05014                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
palh  Pantoea alhagi
Brite
KEGG Orthology (KO) [BR:palh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B1H58_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ARJ40668
UniProt: A0A1W6B0R5
Position
175180..176778
Genome map
AA seq 532 aa AA seqDB search
MSDYSTFARYNSRFPTLYPARSGRQQRLRMAIAGLLLLVAIGWMMAQLTAEMRASGNVFT
PDLLLSGALLLALGFIFVNGMHDTAHAVTTVIYTGTLSPGRAVLISAIANMLGVLLASGV
VAWGVMSLLPAEGLLQMDARHGYALIYALLLSAISWNLASWYFAIPSSSSHALLGAMVGV
GGASSLLNGNGALTGIDCHQAGWAGWALLLSPVLGFVAAGLLLLAMKALLPTRQLTQAAD
LQCPPPLWLRGMLLLTSSGVSFAHGANDGQKGMGLIMVILLIALPGTFALNRTLPEREIA
SLTVLTAQAQAQLPQRSDLTLPMAESELQRYLQQQHWQQEVLPALGKVTGSLHQQLSALP
HFDRLSTSEATRLRLQMSLTSKTLHQLLNSPAPLTHNERALLTTLAGQLNHASSLIPWWV
KIMVALALGLGTLTGWQRIAITIGERTGKAPLSAAQGASSELVTMTTLGMAEQFGLPVST
TQVLTCGVAGSMVANRSALQWRTLKCMGLVWLLTLPACALMAALFYTLLVML
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattacagcacttttgcccgctataactcacgcttccccacgctttatccggca
cgctccggtcggcaacagcgtctgcgaatggcaatagctggcctgcttctgctggtagcg
atcggctggatgatggcacagcttacggctgagatgcgcgcctcgggcaacgtttttact
cctgacctgctgctgagcggcgccttgctgttggctctgggctttatttttgttaacggc
atgcacgataccgcccatgccgttacgacagtgatttataccggtacgctctccccgggg
cgggcagtgctgatttccgccatcgcgaatatgctgggcgtgctgctggcaagcggcgtg
gtggcctggggcgtcatgtctctgttgccggcagaggggctgctgcaaatggatgcccgt
catggctatgcgctgatttatgccctgctgctgtcggcgattagctggaatcttgccagc
tggtactttgctatcccttcttcctcttcacatgcgctgctgggggcgatggtgggcgtg
ggcggtgccagtagtttgctgaacggcaatggcgcgttgaccggaatcgactgtcatcag
gctggctgggctggctgggcgctgctgctgtcgccggtgctgggttttgtcgccgccggg
ctgttgctgctggcgatgaaggcgctattgccgactcgccagctcactcaggctgccgat
ctgcaatgccctcctccgctctggctgcgcggcatgctgctactgaccagcagcggcgtc
tctttcgcgcacggtgccaacgacgggcaaaaaggaatgggattgattatggtcatcctg
ctgatcgcgctgccgggcacgtttgccctgaaccgcaccctgccggagcgcgaaatagcc
agcttaaccgtactgaccgcacaggcgcaggcgcagctgccgcagcgcagcgatctcacg
ctgccgatggcagaaagtgaactgcagcgctatttacagcagcagcactggcagcaagag
gtattgccagcgctgggcaaagttacgggcagcctgcatcaacagctgagcgccctgccc
cacttcgatcggctctcaaccagcgaggcaacccgcctgcgcctgcaaatgtcgctgacc
agcaaaaccctgcatcagctgttaaacagccctgcgccgctgacgcataatgagcgcgcg
ctgctgacgacgctggccggacagttaaatcacgccagcagcctgatcccctggtgggta
aaaatcatggtggcactggcgctgggattgggtaccttaaccggctggcagcgcatcgct
attaccattggcgaacgcaccggtaaagcgccgcttagcgcagcgcagggtgccagcagc
gaactggtcaccatgacaacgttaggcatggcagagcagtttggcctgccggtttccact
actcaggtactgacctgcggcgtcgcaggcagcatggtggcgaatcgcagcgccctgcag
tggcgaacactgaaatgcatgggcctggtatggctgctgacgttaccggcttgcgcgcta
atggccgcgctgttttatacgctgctggtaatgctataa

DBGET integrated database retrieval system