KEGG   Pantoea alhagi: B1H58_01445Help
Entry
B1H58_01445       CDS       T05014                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
palh  Pantoea alhagi
Brite
KEGG Orthology (KO) [BR:palh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1H58_01445
Enzymes [BR:palh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     B1H58_01445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase LysR_substrate
Motif
Other DBs
NCBI-ProteinID: ARJ40787
UniProt: A0A1W6B134
Position
complement(308314..309105)
Genome map
AA seq 263 aa AA seqDB search
MKVAMGQFAVAREWQKNAHTCIELMQQAQQAGAALLVLPEAVLATDIQDPGLAVREAQPL
DGPFLTQLLAASRESTLTTILTLYVPDGSQRAINAQVALRGGEIIARYDKLHLYDAFAMQ
ESQRVTAGLAVPPLLEVGEMKVGMMTCYDIRFPELARRLALDGADVLVLPSAWVRGPLKE
MHWDVLVTARALENTCYVIAVGECGPRNIGSSLIVDPLGVAIARAAESPALVFAELDAQR
VKSARERLPVLANRRFSRPELDA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgctatggggcagtttgctgtcgcgcgtgaatggcagaaaaatgcacatacc
tgtattgagctgatgcagcaggcgcagcaggcaggcgctgcattgctggtgctgcctgaa
gcggtattagcgaccgatatccaggacccagggctggcagtaagagaggcgcagccgctg
gatggcccttttcttactcagttgctggctgccagccgggaaagcacgctaacgacgata
ttgaccctttatgttcctgatggctcacagcgggcgattaacgcacaggtggctctgcgc
ggcggggaaattattgcacgctacgataagctgcatctttacgatgcatttgcgatgcag
gaatcacagcgcgtcaccgctggcctggctgttccgcctttgctggaggtgggcgaaatg
aaagttggcatgatgacctgttacgatatccgtttcccggagctggcacgtcgcctggcg
ctggatggtgccgatgtgctggtgctgccgtcggcgtgggtcagagggccgctaaaagag
atgcactgggacgtgctggttaccgcaagagcgctggaaaatacctgttatgtgattgcg
gtaggcgaatgcgggccacgtaatattggcagcagcctgattgtcgatccgctgggcgtc
gccattgcccgcgctgcggaaagcccggctctggtatttgccgaactggatgcgcagcgc
gttaaaagcgcccgtgaaaggctgccggttttagccaatcgtcgctttagccgccccgaa
ctggatgcctga

DBGET integrated database retrieval system