KEGG   Pantoea alhagi: B1H58_06685Help
Entry
B1H58_06685       CDS       T05014                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
palh  Pantoea alhagi
Pathway
palh00020  Citrate cycle (TCA cycle)
palh00620  Pyruvate metabolism
palh01100  Metabolic pathways
palh01110  Biosynthesis of secondary metabolites
palh01120  Microbial metabolism in diverse environments
palh01200  Carbon metabolism
Module
palh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
palh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B1H58_06685
   00620 Pyruvate metabolism
    B1H58_06685
Enzymes [BR:palh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     B1H58_06685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARJ41739
UniProt: A0A1W6B3W0
Position
1412216..1413835
Genome map
AA seq 539 aa AA seqDB search
MRKKALLLALCMNAFGLSKHAVAEDKKDVDVLLIGGGIMSATLGTYLQELEPDWTIEMVE
RLDNIAEESSNGWNNAGTGHSALAEMNYTPEKEDGSVDISKAIEINESFQISRQFWASQV
QKGVLHDPRSFINSTPHMSLVWGEENVNLLRKRYEALQKSTLFRGMEYSEDHEQIAKWAP
LMMQGRDPQQKVAATRIDIGTDVNFGEITRQLVASLEKSPNFSLQTRHEVRDIERNDDGS
WNVTVADLTNNGAERVIRAKYVFIGAGGAALPLLQKSGIPEAKNYAGFPVGGSFLVTENQ
EVVKQHLAKVYGKASVGAPPMSVPHLDTRMLDGKQVLLFGPFATFSTKYLKHGSLWDMFG
SITPSNLMPMVHVGLDNFDLVKYLVGQLMLNDDDRYAALKTWFPQAKKEDWHLIQAGQRV
QIIKKDAEKGGVLRLGTEVVTSQDGTISALLGASPGASTAAPIMLNLMQKVFKDKIATPE
WQAKLKEMIPSYGQKLNGNISATEHELAETSRILQLDYSPMTPVAANDETSHVVAAAGK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaagcattgcttctggcgctgtgtatgaatgctttcggcctaagtaagcat
gcagtagcagaagataaaaaggacgtcgatgtactgctcatcggcgggggaattatgagt
gccaccctgggaacctatcttcaggagctggaaccagactggactatcgaaatggtagag
cgtctggataacatcgcagaagagagttcgaacggctggaacaacgccggtacaggccac
tccgcgctggcggaaatgaactatacgccagaaaaagaggatggctctgtcgacatcagc
aaagccattgaaattaacgaatccttccagatttctcgtcagttctgggcctctcaggta
cagaaaggcgttctgcacgatccgcgcagctttatcaattccaccccacatatgagcctg
gtctggggcgaagaaaacgttaatctactgcgtaaacgttatgaagcgctgcaaaagagc
acgctgtttcgcggcatggaatactctgaagaccacgaacaaatcgctaaatgggcgccg
ctgatgatgcaaggccgcgatccgcagcagaaagtggccgcaacgcgcattgatatcggt
actgacgtcaacttcggtgaaatcacgcgccagctggtggcatcactggagaaaagtcca
aacttcagcctgcaaacccgtcacgaagtgcgcgatattgagcgtaacgacgatggtagc
tggaacgttaccgttgccgatctcacaaacaacggcgcagaacgcgtgattagggcgaaa
tatgtctttattggcgctggcggcgcggctctgccgctgctgcagaagagcggcattccg
gaagcaaaaaactacgctggcttcccggtaggtggctccttcctggtaacggaaaatcag
gaagtcgtgaagcagcatctggcgaaagtgtatggtaaggcctcggttggcgcgccgccg
atgtccgtgccgcatctggatacccgcatgctggatggaaaacaggttctgctgtttggc
cccttcgccactttctcaaccaaatatctgaaacacggttccctgtgggatatgttcggc
tccatcacccccagcaacctgatgccgatggtacatgtcggtctggataactttgacctg
gtgaaatatctggtcggccagctgatgctgaacgatgacgatcgctacgcggcgctgaaa
acctggttcccgcaggcgaaaaaagaagactggcatctgattcaggcaggtcagcgcgta
cagatcattaaaaaagatgcagaaaaaggcggcgtattgcgcctgggcactgaagtggtg
acctctcaggacggcaccatttctgctctgctgggcgcatcgccaggcgcttctacggca
gcgccaattatgctgaatctgatgcagaaagtgtttaaagataaaatcgctacgccagaa
tggcaggcgaagctgaaagagatgatcccctcttacggccagaaactgaatggcaatatc
agtgccactgagcatgagctggcggaaaccagccgcatcctgcaacttgattattcgccg
atgacgccagtcgccgctaatgacgaaacgtctcacgttgttgcagcagcaggcaagtag

DBGET integrated database retrieval system