KEGG   Pantoea alhagi: B1H58_07285Help
Entry
B1H58_07285       CDS       T05014                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
palh  Pantoea alhagi
Pathway
palh02020  Two-component system
palh02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:palh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1H58_07285
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    B1H58_07285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:palh01001]
    B1H58_07285
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:palh02022]
    B1H58_07285
   02035 Bacterial motility proteins [BR:palh02035]
    B1H58_07285
Enzymes [BR:palh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     B1H58_07285
Protein kinases [BR:palh01001]
 Histidine kinases
  CheA family [OT]
   B1H58_07285
Two-component system [BR:palh02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   B1H58_07285
Bacterial motility proteins [BR:palh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B1H58_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW CheY-binding HATPase_c Hpt H-kinase_dim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ARJ41846
UniProt: A0A1W6B447
Position
complement(1550123..1552093)
Genome map
AA seq 656 aa AA seqDB search
MDVSDFYQTFFDEADELLADMEKYLLQLDVISPDKEMLDAIFRAAHSIKGGAGTFGFKIL
QETTHLMENLLDDARCGILRLTGEIINLFLESKDIMQDQLDAYKSSQEPDEETFHYICGA
LRQIAQQSKDGSADRTTTAVAAPVNTPAERAFLNITLLNVKEDEGRLLVDELSNLGKVLS
QQQQEERLQVQLETTASADEIEAVLCFIVEAEQVAITAGSAPAEADCSVTPAAAVESSPA
AAKSAPVRPAARAQAAESNSIRVAVEKVDQIINLVGELIITQSMLSQLSATLEPSANDVL
LNSIVQLERNARDLQESVMSIRMMPMEYVFSRFPRLVHDLAGKLGKEVELTLVGGSAELD
KSLIERIIDPLTHLVRNSLDHGIESREERIAKGKSPMGNLTLSAEHQGGNIVIEVSDDGA
GLNREKILARAHAQGMAINDNISNEDVWMLIFAAGFSTAEKVTDVSGRGVGMDVVRRNIQ
EMGGHVEITSEQNKGSTIRIILPLTLAILDGMSVRVADETYVLPLGAVMESLKLTEDSLY
HMAGDELMLQVRGEYIPLITLHYIFDMAEEPAAINDSVAVILQSAGVRYALMVDQLIGQH
QVVVKNLELNYRKVPGISAATILGDGSVALILDVAALAKLCKSKRVATKAGQALPV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaagcgatttttatcagactttttttgatgaagccgatgagctgttagccgat
atggaaaaatatctgctacagcttgatgtcatttcgcccgacaaggaaatgttggatgct
attttccgtgcagcgcattccattaaaggcggtgctggaacgttcggttttaaaatattg
caagaaactactcatttaatggaaaacctgctggatgacgcgcgctgcggtatcctgcgg
ctaaccggcgaaatcattaatctgtttctggagagcaaggatattatgcaagatcagctt
gatgcctataaatcttctcaggaaccggacgaagaaacgtttcactatatctgcggggcg
ttgcggcaaattgcgcaacaaagtaaagatggctcggcagatcggacaacgacggccgta
gcagcgccggtaaatacaccagcagaacgcgccttcctgaatattaccctgttaaacgtt
aaagaagatgaggggcgtctgctggttgatgagctctctaatctggggaaagtgcttagc
cagcaacagcaagaagagcggctacaggttcagttagaaaccacggccagcgccgatgaa
atcgaggcggtgctctgttttattgttgaagcggaacaggtagccattacagcgggcagc
gcaccggcagaggcagactgcagcgtaacgccagccgcagctgttgaaagctctccggca
gcagcgaaaagcgcgcccgtcaggcccgccgctcgtgcgcaggccgccgagtccaatagc
atccgcgttgcggtagaaaaggttgatcagatcatcaacctggtcggcgaactgattatc
acccagtcgatgctttcgcagctttccgccactctggagccgtcagcaaatgacgtgctg
ttaaacagcatcgtccagctggagcgcaacgcgcgcgatctgcaggagtcggtgatgtcc
attcgcatgatgccgatggagtatgtatttagccgcttcccgcggctggtgcatgactta
gccggcaagttgggcaaagaggtcgaactgacgctggtaggcggttccgccgaactggat
aaaagcctgattgaacgtatcatcgatcctctgacgcatttggttcgtaacagcctcgat
cacggtattgaaagccgtgaggaacgcatagcgaaaggcaaatccccgatgggcaacctg
acgctgtcagcagaacatcagggcgggaacattgttattgaagtcagcgatgatggcgca
ggcctgaaccgcgaaaagatccttgcacgtgcgcacgctcagggaatggcaattaacgat
aacatcagcaatgaagatgtctggatgttaattttcgcggccggcttctccacggcggaa
aaggtaacggatgtctccgggcgcggcgtcggcatggacgtggtcagacgtaatattcag
gaaatgggcggtcatgtagagattacctctgagcaaaataaaggctcgacgatccgcatt
attctgccgttaaccctggcgatacttgatggtatgtcggttcgtgttgccgatgaaacc
tatgtactgccgcttggtgccgttatggagtcgctgaaactcacagaagattctctttat
catatggcaggcgatgagctgatgctgcaggtgcgtggcgaatatatcccgctcattacg
ctgcactacatatttgatatggcagaggagcctgccgcgattaatgacagcgttgcggtg
attttacaaagtgctggtgtgcgttacgccctgatggtcgatcagctcattggccagcat
caggtagtggtaaaaaatcttgagcttaactatcgcaaagtgcctggtatctctgccgca
accattttaggcgatggcagcgtggcgttgattcttgacgtcgctgcgctggcgaaactg
tgtaaatccaagcgcgtcgcgacgaaagccgggcaagcgctccctgtttaa

DBGET integrated database retrieval system