KEGG   Pantoea alhagi: B1H58_14235Help
Entry
B1H58_14235       CDS       T05014                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
palh  Pantoea alhagi
Pathway
palh00450  Selenocompound metabolism
palh00970  Aminoacyl-tRNA biosynthesis
palh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B1H58_14235 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B1H58_14235 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:palh01007]
    B1H58_14235 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:palh03016]
    B1H58_14235 (metG)
Enzymes [BR:palh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B1H58_14235 (metG)
Amino acid related enzymes [BR:palh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B1H58_14235 (metG)
Transfer RNA biogenesis [BR:palh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B1H58_14235 (metG)
 Prokaryotic type
   Other AARSs
    B1H58_14235 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ARJ43072
UniProt: A0A1W6B7L0
Position
complement(3035660..3037690)
Genome map
AA seq 676 aa AA seqDB search
MTQVAKKIMVTCALPYANGPIHLGHMLEHIQADIWVRYQRMRGNQVWFICADDAHGTPIM
LKAQQMGITPEQMIAEMSQAHQKDFAGFNISYDNYHSTHSDENRELSELIYTRLKENGFI
KNRTISQLFDPEKGMFLPDRFVKGTCPKCKSADQYGDNCEVCGATYSPTELIDPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPGAPGKYFYVWLDAPIGYMGSFKNLCDKRGDLNFDEYWQKDSTTELYHFIGKDIVYF
HSLFWPAMLEGSNFRKPNNLFVHGYVTVNGAKMSKSRGTFIKASTWLEHLDADSLRYYYA
AKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFIAKRFGGKLADHLADPALYKT
FTDAADSIGDAWLSREYGRAIREIMALADVANRYVDEQAPWVVAKQEGRDADLQAICTMG
INLFRVLMTWLKPVLPSLSERAEGFLKTELQWDAIATPLLDHEVATFKALYSRIEMPKVN
ALIEASKEDAAAAAKPTVSGPLADDPIADTITIDDFAKVDMRVALIKTAELVEGSDKLLR
LELDVGGETRQIFSGIRAAYPDPSVLVGRHTIIVANLAPRKMRFGVSEGMVLSAGPGGKD
LFILGAEGAQPGMPVK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaaaaaaataatggtaacgtgcgctctgccgtacgctaatggccct
atccatctcggccatatgctggagcacattcaggctgatatttgggtccgttaccagcga
atgcgcggcaatcaggtttggttcatttgtgccgacgacgcgcacggcaccccgattatg
ctgaaagcacagcagatgggaattacgcctgagcagatgattgctgagatgagtcaggcg
catcagaaagatttcgctggctttaacatcagctacgacaactatcactccacgcacagc
gatgagaaccgcgagctgtcggagctgatttatacccgtctgaaagagaacgggtttatt
aaaaatcgtactatttcgcagttattcgatccggaaaaaggcatgtttctgccggatcgc
tttgtaaaaggcacctgcccgaaatgtaaatcggccgaccagtatggtgataactgcgaa
gtgtgcggcgcaacctatagcccgaccgagctgatcgatccgaaatcggtggtttccggc
gcgacgccggtgatgcgtgattctgagcatttcttcttcgacctgccctccttcagcgaa
atgctgcaggcctggactcgctccggcgcattgcaggagcaggtagcaaataaaatgcag
gagtggtttgaatcgggtctgcaacagtgggatatctcccgcgatgcgccctatttcggc
tttgagatcccgggcgcgccgggtaaatatttttatgtctggctggatgcgccgatcggc
tatatgggctcgttcaaaaacctgtgcgataagcgcggcgatctgaactttgacgaatac
tggcagaaagactccactaccgagctgtatcactttatcggtaaggatattgtttacttc
cacagcctgttctggccagccatgctggaaggcagcaatttccgtaagccgaacaacctg
tttgttcatggctacgtgacggtaaacggcgccaagatgtctaaatcgcgtggcaccttt
atcaaggccagcacctggcttgagcatctggatgctgacagcctgcgctattactatgcg
gccaagctctcttcacgcatcgatgatattgaccttaacctggaggatttcgtccagcgc
gttaatgccgatatcgtcaataaagtggttaacctggcttcacgcaacgccggctttatt
gccaaacgtttcggcggcaagctggcagaccacctggccgatccggcgctgtataagacc
tttaccgatgccgctgacagcattggcgatgcctggctcagccgcgaatatggtcgtgcg
atccgtgaaatcatggcgctggcggacgtggctaaccgctatgttgatgaacaggccccg
tgggtggtggcgaagcaggaaggccgcgatgccgatctgcaggcgatctgcaccatgggc
attaacctgttccgcgtgctgatgacctggctgaagccggtactgccatcgttaagtgag
cgcgcggaaggcttcctgaaaactgaactgcagtgggatgcaatcgctacgccgctgctg
gatcatgaagtcgccacgtttaaagccctttacagccgtatcgaaatgccgaaggtaaac
gccctgatcgaagcatcgaaagaagatgccgctgccgccgcaaaaccgacggtctccggc
ccgctggcagacgatcccatcgctgacaccattaccatcgacgattttgccaaagtggat
atgcgcgtggcattgattaaaaccgccgagctggttgaaggttccgataagctgctgcgt
ctggaactggatgtgggtggtgaaacgcgccagatcttctccggtattcgcgccgcttac
ccggatccgtcggtgctggtggggcgtcataccattatcgtggctaacctggcaccgcgt
aaaatgcgctttggcgtatcggaaggcatggtgctgtcggctggtccgggtggtaaagat
ctgtttattctcggcgcggagggcgctcagcccggcatgccggtaaaataa

DBGET integrated database retrieval system