KEGG   Pantoea alhagi: B1H58_15760Help
Entry
B1H58_15760       CDS       T05014                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
palh  Pantoea alhagi
Pathway
palh00250  Alanine, aspartate and glutamate metabolism
palh00330  Arginine and proline metabolism
palh01100  Metabolic pathways
palh01110  Biosynthesis of secondary metabolites
palh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1H58_15760 (putA)
   00330 Arginine and proline metabolism
    B1H58_15760 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:palh03000]
    B1H58_15760 (putA)
Enzymes [BR:palh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     B1H58_15760 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     B1H58_15760 (putA)
Transcription factors [BR:palh03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    B1H58_15760 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ARJ43348
UniProt: A0A1W6B8C8
Position
complement(3319948..3323898)
Genome map
AA seq 1316 aa AA seqDB search
MATTTMGVKLDEATRERIKQAAQHIDRTPHWLIKQAIFNYLEQLEQGTQPAEYPLQAAAN
ESEEALPEEPHQPFLDFAEQILPQTVTRAAITSAWRRPEPEAVSMMLEQARLPAPLAEKA
HQLAWSLADKLRHQKGATGRAGMVQSLLQEFSLSSQEGVALMCLAEALLRIPDKPTRDAL
IRDKISNGNWQAHLGRSPSLFVNAATWGLLFTGRLVATHNEANLSRSLNRIISKSGEPLI
RKGVDMAMRLMGEQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTASDAKAYLLSY
QQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYSRVMEELYPILKSLTLLARSYD
IGINIDAEEADRLELSLDLLEKLCFEPELEGWNGIGFVIQAYQKRCPFVIDALIDLAQRS
RRRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDISYLACARKLLAVPNLIYPQF
ATHNAHSLAAIYHLAGNNYYPGQYEFQCLHGMGEPLYEQVVGKTADGKLNRPCRIYAPVG
THETLLAYLVRRLLENGANTSFVNRIADKTLPLDELVADPVQQVERLAATEGAIGLPHPK
IPLPRDLYGDKRPNSAGLDLANEHRLASLSSALLSSAAHLWRAEPMIEGELGQGEYRPVL
NPADPSDRVGEVREASEQEVAQALEASVNAGPIWFATPAQERAAILERAAELMEGQMQTL
IGILVREAGKTFSNAIAEVREAVDFLYYYAGLVSSDFDNETHRPLGPVVCISPWNFPLAI
FTGQIAAALAAGNSVLAKPAEQTPLIAAQAVRILLEAGVPAGVIQLLPGLGETVGAQLTG
DDRVRGVMFTGSTAVASLLQRNLAGRLDPQGRPTPLIAETGGMNAMIVDSSALTEQVVLD
IVSSAYDSAGQRCSALRLLCIQEDAAEHTLKMLRGAMAECRMGNPERLSTDIGPVIDAEA
KENIERHIQAMRAKGLTVFQAVQENQQDSKEWTQGTFIKPTLIELNSIDELDKEIFGPVL
HVVRYTRSSLPQLIEQINASGYGLTLGVHTRIDETIGQVTQRAKVGNLYVNRNMVGAVVG
VQPFGGEGLSGTGPKAGGPLYLYRLLSHRPDNALQVTLDRHDAEQTLDATLRPALIEAHK
ALSDWANAQPQLAEVCARYEKLAQGGTVRLLPGPTGERNTYILLPRERVLCLADNEQDAL
VQLAAVTSVGSRALWQDDELHRKLAQSLPEKVRAHIDFAHDPLAQEQHYDAVIYHGDADQ
LRLLCEKIAARGGAIVSVQGFARGETNLLLERLLIERSLSVNTAAAGGNASLMTIG
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacgacaatgggtgtcaaactggatgaagccacccgcgaaagaatcaaacag
gctgcacaacatatcgatcgcaccccgcactggctgatcaaacaagcgatttttaactat
cttgagcagctggaacagggcacgcagcccgctgaatatccgctgcaggcagcagcaaat
gaatcagaagaggcattgccggaagagccgcatcagccgtttcttgatttcgctgaacag
atcctgccacaaacggttacccgtgcagccattacctctgcctggcgtcgcccggaacct
gaagccgtctcaatgatgctggagcaggcgcgtttacctgccccgctggcagaaaaagcc
catcagcttgcgtggtcgctggcggataagctgaggcaccaaaaaggggcaaccggacgc
gccggaatggtgcaaagcctgctacaggagttctcgttatcttctcaggaaggtgtggcg
ctgatgtgtctggcggaagcgctgctgcgcatccccgataagccgacacgcgatgcgctg
atccgcgataaaatcagcaacggcaactggcaggcgcatctgggccgcagtccttcgctg
tttgtgaatgccgccacctggggtctgctgtttaccggccgtctggtcgcaacgcataat
gaagccaacctgtcgcgctcccttaaccgtattatcagtaaaagcggcgagccgctgatc
cgcaaaggcgtggatatggcgatgcgtttgatgggcgagcagtttgttaccggcgaaacc
atcgcagaagcgctggccaatgcccgtaaactggaagaaaaaggcttccgctactcttac
gatatgctgggcgaagcggcgctgaccgccagcgatgcgaaagcgtatctgctctcttat
cagcaggcgatccatgccattggcaaagcctccaacgggcgcggtatttatgaaggcccg
gggatttcgatcaagctttctgcgctgcatccacgctacagccgcgcgcaatactcgcgc
gttatggaagagctctaccctattcttaaatcgttgacgctgctggcgcgttcttacgat
atcgggattaatattgatgccgaagaggcggatcgtctggagctgtcactcgatctgctg
gaaaaactctgcttcgagccggaactggaaggctggaacggcatcggcttcgttattcag
gcttatcagaagcgttgtccgtttgtgattgacgcactgatcgatctggcgcagcgcagc
cgtcgtcgtctgatgattcgtctggtaaaaggcgcttactgggacagcgaaatcaaacgc
gcgcaggtcgaagggctggaaggctacccggtctatacccgcaaggtctacaccgatatc
tcttacctggcctgcgcccgcaagctgctggctgtgcctaacctgatttatccgcagttc
gccacccataatgcccacagcctggcggcgatctatcatctggcgggcaataactattat
cccggtcagtatgagtttcagtgtctgcacggcatgggcgagccgctgtatgagcaggtg
gtgggcaaaaccgctgatggcaagctgaaccgcccgtgccgtatctatgcaccggtcggc
acccatgaaaccctgctggcttacctggtgcgtcgtctgctggaaaatggcgctaatacc
tcgtttgttaaccgtatcgcggataaaaccctgccgctggatgagctggtggccgatccg
gttcagcaagttgagcgtctggccgcaacggaaggtgccattggtttgccgcatccgaaa
attccgctgccacgcgatctgtatggtgataaacgccccaactccgccggactggattta
gctaacgaacatcgcctggcgtcactctccagcgccctgttaagcagcgccgcgcattta
tggcgtgccgaaccgatgattgaaggagagctgggccagggtgaataccgcccggtactg
aacccggccgatccttccgaccgggtgggcgaagtgcgtgaagccagcgagcaggaggtc
gcacaggcgctggaggcgtcggtgaatgctggtccaatctggtttgccaccccagcgcag
gagcgcgccgctattctggagcgcgccgctgaactgatggaaggtcagatgcagacgctt
atcggcatcctggtgcgcgaagcgggtaaaaccttcagtaacgcgattgctgaagtgcgc
gaagcggtcgatttcctctattactatgccggcctggtaagcagcgactttgataatgaa
acccatcgtccattagggccggtggtctgtatcagcccgtggaacttcccgctggcgatc
tttaccggacagattgccgccgccctggcggcgggcaacagcgtgctggcgaaacccgca
gagcaaacgccgctgattgccgctcaggcagtacgcattctgcttgaagcgggcgtgccg
gctggcgtgatccagctactgccgggcctcggcgagaccgtaggcgcccagttgaccggc
gacgatcgggtgcgcggcgtcatgtttaccggctcgaccgcggtggcgagtttgttacaa
cgtaacctggccggacgcctcgatccacagggccgcccaacgccgctgattgccgaaacc
ggcggaatgaacgcgatgattgtcgactcctccgcgctgaccgagcaggtggtactggat
atcgtctcctctgcttatgacagcgcgggccaacgctgttcggcgctgcgcctgctttgc
atccaggaggacgccgccgagcatacgttgaagatgctgcgaggcgcgatggcggaatgc
cgtatgggtaatcctgaacgcctctcaaccgatatcggtccggtaattgatgccgaggcg
aaagagaatattgagcgtcatattcaggcgatgcgcgccaaagggctaacggtgttccag
gcggtacaggagaatcagcaggacagcaaagagtggacgcagggcacctttattaagccg
acgctgattgagctgaacagtatcgatgaactggataaagagatttttggtccggtattg
catgtggtgcgttatacgcgcagctcactgccgcagctgattgagcaaatcaatgcttct
ggttatggcttaacgctgggcgtgcatacccgtatcgatgaaactatcggtcaggtaacc
cagcgtgcgaaagttggtaacctgtacgttaaccgtaatatggttggcgcagtggttggc
gtacaaccgttcggcggcgaaggcttgtcaggtaccggcccgaaagcaggtggcccgctt
tacctctatcgtctgttgtcgcatcgtccggataatgcgctgcaggtcacgctcgatcgt
cacgatgccgaacagacgcttgatgccacactgcgccctgcccttatcgaagcgcacaaa
gcgctgagcgactgggccaacgcgcagccgcagctggcggaagtttgcgcccgctatgaa
aaactggcgcagggcggcacggtacgcttgctgccgggcccaaccggcgagcgcaatacc
tatattctgctgccacgcgagcgcgtgctctgtctggcggataacgagcaggatgcgctg
gtacagctggcagcggtgaccagcgtcggcagtcgcgctttgtggcaggatgatgagctg
catcgtaagctggcgcagtcgctgccggagaaagtgcgtgcacatatcgacttcgcccat
gatccgctggctcaggaacagcactatgatgcggtgatctatcacggcgacgccgatcag
ctgcgtttgctgtgcgagaagattgccgcacgcggcggcgcgatcgtttcagtgcagggc
tttgcccgtggcgaaaccaatctgctgctggagcggctgttaattgaacgctcgctgagc
gtcaataccgctgcggcgggaggaaacgccagcctgatgacgattggctaa

DBGET integrated database retrieval system