KEGG   Pantoea alhagi: B1H58_19215Help
Entry
B1H58_19215       CDS       T05014                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
palh  Pantoea alhagi
Pathway
palh00480  Glutathione metabolism
palh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B1H58_19215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:palh02000]
    B1H58_19215
Enzymes [BR:palh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B1H58_19215
Transporters [BR:palh02000]
 Other transporters
  Pores ion channels [TC:1]
   B1H58_19215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 DUF4953
Motif
Other DBs
NCBI-ProteinID: ARJ44355
UniProt: A0A1W6BB64
Position
4037765..4038361
Genome map
AA seq 198 aa AA seqDB search
MKIYTYPKSRSLRVLWTLEEMELPYQPVRVALKPGEPGIRSPHPQRKVPVLEDGSFFLAE
TQAICKFICTKYAGRVLYPVQPEEQAIIDQWLSFAITELEAPVWLTLKHKLLLPEPARVK
AVAESAAADAQTALRLLSQARLDRWIAGENFTLADIFLAHNLAWAQAAGLTLSESLADYV
KRCFSRPASLRAVEMNNR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ctgaaaatctacacctatcctaaaagccgctcgctgcgtgtgttatggacgctggaagaa
atggagctcccttatcagcccgtccgggtcgccctgaagccgggagagccaggaataaga
tcgcctcatcctcagcgtaaagttccggtgctggaagatggctcattttttctggctgaa
acgcaggctatctgtaaatttatctgcacgaaatatgcaggacgcgtgctctatccggtg
cagccggaggagcaggcgatcatcgatcaatggttaagctttgcaataaccgagctggaa
gcgcccgtgtggctaacgttaaagcacaagctgctgttgcctgaaccagcgcgggtaaag
gccgttgccgaaagcgctgcggctgatgctcagacggcgctgcgcctgctgtcgcaggcc
cgtttggatcgctggatcgccggtgaaaactttaccctggccgatattttcctggcgcat
aatcttgcctgggcgcaggcggctggcctgacgcttagcgaatcgttagcagattatgta
aagcgctgtttttcccgtcccgccagccttcgggcagtagaaatgaataatcgttag

DBGET integrated database retrieval system