KEGG   Psychrobacter alimentarius: A3K91_0739Help
Entry
A3K91_0739        CDS       T04320                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00230  Purine metabolism
pali00240  Pyrimidine metabolism
pali01100  Metabolic pathways
pali01110  Biosynthesis of secondary metabolites
pali01130  Biosynthesis of antibiotics
Module
pali_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pali_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pali_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pali00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A3K91_0739
   00240 Pyrimidine metabolism
    A3K91_0739
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pali04131]
    A3K91_0739
Enzymes [BR:pali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     A3K91_0739
Membrane trafficking [BR:pali04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    A3K91_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AMT96361
UniProt: A0A144NNN7
Position
878164..878595
Genome map
AA seq 143 aa AA seqDB search
MANERTLSIIKPDAVAGNHIGAIYSRFEEAGLKIVAAKMLQLDDEKAGGFYAEHAERPFY
NDLKSFMMSGPVLVSVLEGENAIAKHREIMGATNPKEAAEGTIRADFASSIDENAVHGSD
SAESAKREISYFFNDDEVCARTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaacgtactctatctatcatcaagcctgacgcggttgctggcaaccatatc
ggcgctatctacagccgctttgaagaagctggtctaaaaatcgttgcagcaaaaatgcta
caacttgatgatgaaaaagcaggcggtttttacgcagagcacgcagagcgtccgttttac
aatgatctaaaatcgttcatgatgtcaggtccagtattggtatcagtattagaaggcgaa
aacgccatcgctaagcatcgtgaaatcatgggtgcaaccaatcctaaagaagcagctgaa
ggcactatccgtgccgacttcgctagcagcatcgatgaaaacgctgttcatggttcagat
tcagctgaatcagccaaacgtgaaatcagctacttcttcaacgatgacgaagtatgtgca
cgtacgcgttaa

DBGET integrated database retrieval system