KEGG   Psychrobacter alimentarius: A3K91_0913Help
Entry
A3K91_0913        CDS       T04320                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00450  Selenocompound metabolism
pali00970  Aminoacyl-tRNA biosynthesis
pali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pali00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A3K91_0913
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3K91_0913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pali01007]
    A3K91_0913
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pali03016]
    A3K91_0913
Enzymes [BR:pali01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A3K91_0913
Amino acid related enzymes [BR:pali01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A3K91_0913
Transfer RNA biogenesis [BR:pali03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A3K91_0913
 Prokaryotic type
   Other AARSs
    A3K91_0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF4413
Motif
Other DBs
NCBI-ProteinID: AMT96528
UniProt: A0A144NTV0
Position
complement(1101205..1103301)
Genome map
AA seq 698 aa AA seqDB search
MKVREILVTSALPYANGHIHLGHLVEYIQTDIWVRAMKAQGHQVNYVCADDAHGTAIMLK
AEANGVTPEAQIASVKASHEADFSKFLIDFDNYHSTHSEENKQFSELIYRRLNDAGHIST
KDVEQLFDPEKQLFLADRFVKGTCPECDSPDQYGDNCEVCGTTYDATDLKDPHSTLSDAT
PVLKTSKHYFFDLPEFEQFLKDWTRSDSRLQTSVANKLQEWFDAGLASWDISRDAPYFGF
QIPDTPSDEPDKYFYVWLDAPVGYMASFKNLCDKRIGTENALDFDRYWMQENEHKTEVYH
FIGKDIVYFHALFWPAMLAGSEFRTPTGVFAHGFLMVNGEKMSKSRGTFIKAETYAEHLH
PEYLRYYFASKLSDKVEDINLDLEDFMQKVNSDLVGKVVNIASRSAGFLVKKYDGMLSEV
CVEPELLEDITKTGDEIAAAYENREFSRAMRLIMQCADKANEYIDGKKPWSLAKQEGTEQ
EVQDVCSVAINIFRQLMVYLAPVLPELTNNAKEFLNIDDLSFASRNEWLLGHKINKFKPL
MQRIEEKDIIAMVEDSKASLTQAASLATSEDSTPVKQNQQPAPIETEQTDYIGIEDFAKV
EMKVAHVLACNHVEGADKLLQFTLDVGEEKPRNVFSGIRKFYEPEQLLGKKVICVTNLAP
RKMKFGVSEGMVLSTGNPKTGLTVVTLPDDCVVGDTLA
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcgtgagattctagtaaccagtgcgctgccctacgccaatggccatatccat
ttggggcatcttgtagaatatattcagacagacatttgggtacgcgcaatgaaagcgcaa
ggccatcaagtcaactatgtctgcgcggatgatgcacacggtacggcaatcatgctcaag
gcagaagccaacggcgtaacaccagaggcgcaaattgcttcagtgaaagcgtcgcacgaa
gcagatttcagtaaatttttgattgattttgataattaccactccacgcattctgaagaa
aacaagcaattctctgagctgatttatcgtcgccttaatgatgctggccatatcagtaca
aaagatgttgagcaactttttgatccagaaaagcagttgtttctagcagatcgttttgtc
aaaggaacttgcccagagtgtgattcaccagaccagtacggcgataactgtgaagtttgt
ggcaccacttatgatgcgacagatctgaaagatccgcactcaacgttgtctgatgcaacg
cctgtactcaaaacttctaagcattatttctttgatttgcctgagtttgagcagttctta
aaagactggacacgcagtgacagtcgtctacaaacatcagtcgctaacaaactacaggaa
tggtttgatgctggacttgccagctgggatatctcacgtgatgcgccctacttcggcttt
caaattccagatacgccaagtgatgagccggacaaatacttttatgtctggctcgatgcg
ccagtcggctacatggcaagctttaaaaacctatgtgataaacgcataggtactgaaaac
gcgctggattttgaccgttactggatgcaagaaaacgagcacaaaactgaagtttatcac
ttcatcggtaaagacatcgtttatttccatgctctattttggccagccatgcttgcgggt
agtgagttccgtacaccaacgggcgtttttgctcatggtttcttgatggtcaatggcgaa
aaaatgagtaagtcgcgcggcacctttatcaaagccgaaacttacgctgagcacttgcat
cctgagtacctgcgttattactttgccagtaagctgtctgacaaagtcgaggatatcaac
cttgacttagaagactttatgcaaaaggtcaactctgacttggtcggtaaagtggtcaat
attgccagtcgtagcgcgggtttcttggtcaaaaaatacgatggcatgctgtcagaggtt
tgcgtagagcctgagctgttagaagacatcaccaaaactggcgatgagattgccgcggct
tatgaaaatcgtgagttctcacgtgcgatgcgtttaatcatgcaatgtgcggacaaagcc
aacgaatatatcgatggtaaaaaaccgtggtcactagcgaaacaggaaggcactgagcaa
gaagtacaagacgtttgctcggtggcgattaatatcttccgtcaattgatggtctatctt
gcgccagtactgcctgagctgacaaataatgccaaagagtttttgaatattgatgattta
agctttgccagccgcaacgagtggttgcttggacataaaattaacaagttcaaacccttg
atgcagcgtattgaagaaaaagacattattgcgatggtagaagattcaaaagcgtcgttg
acacaagccgcatcactagcgactagcgaagacagtacgccagtcaagcaaaaccagcag
cctgcacccatcgagactgaacagactgactatatcggtatcgaagactttgccaaagtc
gagatgaaagtggcgcacgtcttagcatgcaatcacgtagaaggtgctgataagctacta
cagttcaccttggatgttggcgaagaaaagccacgtaatgtgttcagtggtattcgtaaa
ttttatgagcctgagcagctgcttggtaaaaaggtgatttgcgtcaccaaccttgcgccg
cgcaagatgaaatttggtgtctcagaaggcatggtgctatcaactggcaatccaaaaacg
ggtttaacagtcgtcacattgcctgatgattgtgtcgttggggacactttggcttaa

DBGET integrated database retrieval system