KEGG   Psychrobacter alimentarius: A3K91_1027Help
Entry
A3K91_1027        CDS       T04320                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pali  Psychrobacter alimentarius
Pathway
pali00071  Fatty acid degradation
pali00072  Synthesis and degradation of ketone bodies
pali00280  Valine, leucine and isoleucine degradation
pali00310  Lysine degradation
pali00362  Benzoate degradation
pali00380  Tryptophan metabolism
pali00620  Pyruvate metabolism
pali00630  Glyoxylate and dicarboxylate metabolism
pali00640  Propanoate metabolism
pali00650  Butanoate metabolism
pali00900  Terpenoid backbone biosynthesis
pali01100  Metabolic pathways
pali01110  Biosynthesis of secondary metabolites
pali01120  Microbial metabolism in diverse environments
pali01130  Biosynthesis of antibiotics
pali01200  Carbon metabolism
pali01212  Fatty acid metabolism
pali02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3K91_1027
   00630 Glyoxylate and dicarboxylate metabolism
    A3K91_1027
   00640 Propanoate metabolism
    A3K91_1027
   00650 Butanoate metabolism
    A3K91_1027
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3K91_1027
   00072 Synthesis and degradation of ketone bodies
    A3K91_1027
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3K91_1027
   00310 Lysine degradation
    A3K91_1027
   00380 Tryptophan metabolism
    A3K91_1027
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3K91_1027
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3K91_1027
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A3K91_1027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pali04147]
    A3K91_1027
Enzymes [BR:pali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3K91_1027
Exosome [BR:pali04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3K91_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMT96641
UniProt: A0A144NXB0
Position
complement(1245014..1246414)
Genome map
AA seq 466 aa AA seqDB search
MSNKNNHADSPVVESTVVKASNEKKQKPAATKSRKSGLASGQNRVAILGGNRIPFARSNG
SYADVSNTDMLTAALDGLIERYNLQDEVLGEVVSGAVMKLSRDINLTREATLNTALSPHT
PTYDISQACGTGLQATFASANKIALGLIDSAITGGVDTTSDAPIAIGDGLRKVLIKLGAA
KDNKQRLKALMGLNPKDLIDSPQNGEPRTGLSMGEHQAITTLEWNISREAQDELAFNSHK
NLARAYDEGFFDDLITPYKGLTRDNNLRPDTTLEKLGKLKPVFGKKNANPTMTAANSTPL
TDGASCVLLGTDEWAKEHNLKPLAYIVHQETAAVDFIGKSGTTEGLLMAPAYAVPRMLER
AGLTLQDFDFYEIHEAFASQVLSTLAAWEDQKFCEERLGLDAPLGAIDRNKLNVNGSSLA
AGHPFAATGARILATAAKLLDQKGSGRALISICAAGGQGVTCILEK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaaacaatcacgccgatagtcctgtagtagaaagcactgttgtaaaagcc
agtaatgaaaaaaaacaaaagccagcagcaaccaaaagtcgtaaatctggactagcctcg
gggcaaaatcgagtggctatcttagggggcaaccgtattccgtttgctcgctcaaacggt
tcatacgctgatgttagtaatacagacatgctaacggctgctttagacggtttgattgag
cgctataacctacaagatgaagtactgggtgaagtggtgtctggtgctgtcatgaaattg
agccgcgatatcaatcttactcgtgaagcaacattgaacacagcgctcagcccgcatacg
ccaacttacgacatctcacaagcttgtggcacaggtttacaagcgactttcgcttctgcc
aataagattgccttgggtctgattgactcagccatcacaggtggtgttgatacgacctcc
gatgcacctattgccattggcgatggtttacgcaaagtccttatcaagttaggtgctgca
aaagacaataaacaacgcctaaaggccttaatgggtctaaacccaaaagacttgattgac
tcaccacaaaatggcgagccgcgcacaggtctatcaatgggtgagcatcaagccattacg
acacttgaatggaatatcagtcgtgaagcacaagatgagctggcttttaatagccataaa
aatcttgcccgtgcttatgatgaaggcttctttgatgacttaatcacgccatataaaggt
ttgacgcgtgataataacttgcgtccagacacaactttagaaaagttaggcaaactaaag
cctgtgtttggcaaaaagaatgccaacccaacaatgacagcggccaactctactccctta
accgatggtgcctcttgtgtactattgggtactgatgaatgggcaaaagagcacaatcta
aaaccactggcttacatcgtacaccaagaaacagcagccgttgatttcattggtaagtct
ggtaccacagaaggcttactcatggcaccagcttatgcggtaccacgtatgcttgagcgt
gctggcttgacactgcaagattttgacttttatgagattcacgaagcgtttgcttcacaa
gtattgtcaacgcttgccgcttgggaagaccagaagttttgcgaagagcgcttaggtctt
gacgcgccacttggtgctattgatcgcaacaaacttaatgtaaatgggtcatcattagca
gcaggtcatccatttgctgccactggcgctcgtatcttagcaactgcggcaaaattattg
gaccaaaaaggatctggtcgtgcgctcatctctatctgtgcagcaggtggtcaaggtgtg
acttgcatcctagaaaaatag

DBGET integrated database retrieval system