KEGG   Pseudomonas alkylphenolica: PSAKL28_06290Help
Entry
PSAKL28_06290     CDS       T03238                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00130  Ubiquinone and other terpenoid-quinone biosynthesis
palk00627  Aminobenzoate degradation
palk01100  Metabolic pathways
palk01110  Biosynthesis of secondary metabolites
palk01120  Microbial metabolism in diverse environments
palk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PSAKL28_06290
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PSAKL28_06290
Enzymes [BR:palk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     PSAKL28_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AIL59863
UniProt: A0A077F372
Position
687345..687974
Genome map
AA seq 209 aa AA seqDB search
MSGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQLVMSTETDVVLPAKPQA
MQAFLTEYTGAAAGQIRVYGKEDWMSPVASGSGAPAAMVVVPCSTGTLSAIATGACNNLI
ERAADVTLKERRQLVLVPREAPFSSIHLENMLKLSNMGAVILPAAPGFYHQPQTIDDLID
FVVARILNVLNIPQDMLPRWGEHHFGADE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggccggaacgcatcaccctggcgatgaccggggcctcgggggcgcagtatggt
ctgcgcctgctcgattgtctggtgcgcgaagaccgtgaggtgcatttcctgatctccaag
gcggcgcaactggtgatgtcgaccgagaccgatgtggtgcttccggccaaacctcaggcg
atgcaggccttcctgaccgagtacaccggcgctgccgccgggcagattcgcgtgtatggc
aaggaagactggatgtcgccggtagcctctggctccggcgcgcctgcggcgatggtggtg
gtgccgtgttccaccggtacgctctcggccattgccaccggggcctgtaacaacctgatc
gagcgtgctgcggatgtcacccttaaggagcgtcggcaactggttctggtgccgcgtgag
gcgccgttttccagtattcatctggagaacatgctcaagttgtcgaacatgggcgcggtg
atcctgccggcggcacctgggttctaccatcagccccagaccatcgacgacttgatcgac
tttgtcgtggcgcggattctcaatgtgctgaatattccccaggacatgctgccgcgttgg
ggcgagcatcacttcggcgccgatgaatga

DBGET integrated database retrieval system