KEGG   Pseudomonas alkylphenolica: PSAKL28_07410Help
Entry
PSAKL28_07410     CDS       T03238                                 

Definition
(GenBank) 4-methyl-3-oxoadipyl-CoA thioesterase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00071  Fatty acid degradation
palk00072  Synthesis and degradation of ketone bodies
palk00280  Valine, leucine and isoleucine degradation
palk00310  Lysine degradation
palk00362  Benzoate degradation
palk00380  Tryptophan metabolism
palk00620  Pyruvate metabolism
palk00630  Glyoxylate and dicarboxylate metabolism
palk00640  Propanoate metabolism
palk00650  Butanoate metabolism
palk00900  Terpenoid backbone biosynthesis
palk01100  Metabolic pathways
palk01110  Biosynthesis of secondary metabolites
palk01120  Microbial metabolism in diverse environments
palk01130  Biosynthesis of antibiotics
palk01200  Carbon metabolism
palk01212  Fatty acid metabolism
palk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSAKL28_07410
   00630 Glyoxylate and dicarboxylate metabolism
    PSAKL28_07410
   00640 Propanoate metabolism
    PSAKL28_07410
   00650 Butanoate metabolism
    PSAKL28_07410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSAKL28_07410
   00072 Synthesis and degradation of ketone bodies
    PSAKL28_07410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSAKL28_07410
   00310 Lysine degradation
    PSAKL28_07410
   00380 Tryptophan metabolism
    PSAKL28_07410
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSAKL28_07410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSAKL28_07410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSAKL28_07410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:palk04147]
    PSAKL28_07410
Enzymes [BR:palk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSAKL28_07410
Exosome [BR:palk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSAKL28_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIL59975
UniProt: A0A077F6Q7
Position
complement(807839..809017)
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSYQGALAAIPAVDLGAAVIRQLLTLTGIDAELVDEVILGQVLTAG
AGQNPARQAAIKAGLPHAVPAMTLNKVCGSGLKALHLATQAIRCGDAEVIIAGGQENMSL
ANYVMPGARTGLRMGHSTLIDSMISDGLWDAFNDYHMGITAENLVEKYGISREDQDAFAA
ASQQKAAAAIEARRFVDEITPILIPQRKGDPVAFATDEQPRAGTTAESLGKLKPAFKKDG
TVTAGNASSLNDGAAAVMLMSAAKAQQLGLPILARIKAYANAGVDPAIMGIGPVSATRRC
LEKAGWDLADLDLIEANEAFAAQALSVGKELGWDASKVNVNGGAIALGHPIGASGCRVLV
TLLHEMIKRDASKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgttgttatcgttgccgccacccgaaccgctgtcggtagctaccaaggagcg
ctggccgccattcccgccgttgacctcggcgctgcggtgattcgccaactgctgaccctg
accggcatcgatgccgagctggtcgatgaagtgatcctcggccaggtgctgaccgctggt
gccgggcaaaaccctgcgcgccaggccgcgatcaaggccggcctgccccacgcggtaccg
gccatgaccctgaacaaagtctgcggctccggcctcaaggccctgcacctggcaacccag
gccatccgctgcggcgacgccgaagtgatcatcgccggcggccaggaaaacatgagcctg
gccaactacgtcatgcccggcgcccgtaccggtttgcgcatgggccacagcaccctgatc
gacagcatgatcagcgacggtctgtgggatgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggaaaagtacggcatcagccgtgaagaccaggatgccttcgccgcc
gcctcccagcaaaaagctgctgccgccatcgaagcccgacgcttcgtcgacgaaatcacc
ccgatcctgattcctcagcgcaagggcgatccggttgccttcgccactgacgaacaacca
cgtgccggcactaccgccgaatcgctgggcaagctcaagccggccttcaagaaagacggc
accgtcactgccggtaacgcttcgtcgctcaacgacggtgccgccgccgtgatgctgatg
agtgcagccaaggcccagcaactgggtctgccgatcctggcgcggatcaaggcctacgcc
aatgccggcgtcgaccctgcgatcatgggcatcggcccggtcagcgccacccgccgctgc
ctggaaaaggccggctgggatctggccgacctggacctgatcgaagccaacgaagccttt
gccgcccaggccctgtcggtaggcaaggagctgggttgggacgccagcaaggtcaacgtc
aacggcggcgccattgccctgggccacccgatcggtgcttcgggttgccgggtgctggtg
accctgttgcacgagatgatcaagcgtgatgccagcaaaggcctggccaccttgtgcatc
ggcggcggccagggtgtagccctggcgatcgaacgctga

DBGET integrated database retrieval system