KEGG   Pseudomonas alkylphenolica: PSAKL28_07840Help
Entry
PSAKL28_07840     CDS       T03238                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00730  Thiamine metabolism
palk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PSAKL28_07840
Enzymes [BR:palk01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     PSAKL28_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like GIDA Pyr_redox_2 FAD_oxidored ApbA NAD_binding_9 Pyr_redox NAD_binding_8 FAD_binding_3 Bromo_TP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AIL60018
UniProt: A0A077F3M5
Position
859460..860563
Genome map
AA seq 367 aa AA seqDB search
MTKQVVIVGGGVIGLLTAFNLAAEVEQVVLCDRGELGQESSWAGGGIVSPLYPWRYSPAV
TALAHWSQDFYPQLGERLFTSTGVDPEVHTTGLYWLDLDDEAEALAWAEREGRPLSAVDI
SAAYDAVPVLGAGFQRAIYMAGVANVRNPRLVKSLKAALQAMPNVSIREHCEITGFSQQD
GRITGVETADGLIAGERVVLTAGAWSGDLLRLLGLELPVEPVKGQMILFKCAEDFLPSMV
LAKGRYAIPRRDGHILVGSTLEHAGYDKTPTAEALESLKASAIELLPALADATPVGHWAG
LRPGSPEGIPYIGEVPGWQGLWLNCGHYRNGLVLAPASCQLFADLLLGREPIIDPRPYAP
AGRLTGE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaagtagtgatagtcggcggcggagtgatcggcctgctgacagcgttcaac
ctggcggccgaggtcgagcaggtggtgctgtgtgatcgcggtgagctgggacaggaatcg
tcctgggccggtggcggcattgtttcgccgctctatccctggcgctacagccctgcagtg
acagcgctggcgcactggtcgcaggatttctatccacagctgggtgagcgtttgttcacc
agtaccggggtggatcccgaggtgcataccaccggcctgtactggctggacctggacgac
gaagccgaggctctggcctgggccgagcgggaagggcggccattgagtgcggtggatatc
tctgccgcctatgatgcggtgccagtactcggcgccggtttccagcgcgctatctacatg
gcgggcgtggccaacgtgcgtaacccgcgcctggtcaaatcgctcaaggcggcgctgcag
gcgatgcctaacgtgagtattcgcgagcactgcgaaatcaccggcttcagccagcaggac
gggcgtatcaccggggtcgagacggctgacgggctgattgctggcgagcgcgtggtgctg
actgccggtgcctggagtggcgatctgttgcgtctcctgggcctggagttgccggtcgag
ccggtcaaagggcagatgattctgttcaaatgcgccgaagacttcctgccgagcatggtg
ctggccaaggggcgctacgccatcccgcggcgggacggccatattctggtgggcagtacc
ctggagcatgccgggtacgacaagaccccgaccgccgaagccctggaaagcctcaaggct
tcagccatcgagttgctcccggcgttggccgacgctacgccggttggccattgggcgggt
ttgcgtccgggatcgcccgagggcataccttacattggtgaagtgccgggctggcagggt
ttgtggctgaactgcgggcattaccgcaacggcctggtgctggcgccggcgtcctgccag
ttgtttgccgacctgctactgggccgtgaaccgatcatcgatccacggccttatgcgcca
gcagggcgattgaccggagagtaa

DBGET integrated database retrieval system