KEGG   Pseudomonas alkylphenolica: PSAKL28_10390Help
Entry
PSAKL28_10390     CDS       T03238                                 

Definition
(GenBank) beta-D-glucoside glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00460  Cyanoamino acid metabolism
palk00500  Starch and sucrose metabolism
palk01100  Metabolic pathways
palk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSAKL28_10390
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PSAKL28_10390
Enzymes [BR:palk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PSAKL28_10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like CARDB
Motif
Other DBs
NCBI-ProteinID: AIL60269
UniProt: A0A077F8R0
Position
complement(1136509..1138800)
Genome map
AA seq 763 aa AA seqDB search
MNKLCLLGLVVSLASQSAFADTPAEPLKNKQAFIADLMGQMTLDEKIGQLRLISIGPEMP
REQIRKEIAAGRIGGTFNSITRAENRPMQDAAGRSRLKIPMFFAYDVIHGHRTIFPISLA
LASSWDMDAIAKVGRVSALEASADGIDMTFAPMVDIARDPRWGRTSEGFGEDTYLVSRIS
KVMVESFQGKSPAEATSLMASVKHFALYGAVEGGRDYNTVDMSPTKMFNDYLPPYRAAID
AGAGGVMVALNSINGVPATSNTWLMHDLLRKDWGFKGVTVSDHGAITELVRHGVARDGRE
AAKLAIKAGIDLSMNDSLYDSELASLLKAGEINQADIDNAVREVLGAKYDMGLFADPYRR
IGKASDDPADTYAENRLHRAEARDVARRSMVLLENREQTLPLKKAGTIALVGPLADAPID
MMGSWAAAGRPQQSVTVREGMRQVLGDQAKVIYAKGSNVTHDKAILDYLNFLNFDAPEIV
DDPRPAAVLIDEAVKAAKQSDVIVAVVGESRGMSHESSSRTTLEIPAAQRELIKALKATG
KPLVLVLMNGRPLSLSWEREQADAILETWFTGTEGGNAIADVLFGDYNPSGKLPITFPRS
VGQIPMYYNHLSIGRPFTPGKPGNYTSQYFEEPNGPLYPFGYGLSYSEFSLSPLTLSSKT
LKKGQTLEASIRVKNTGKRDGETVVQLYLQDIAASMSRPIKELKNFQKVMLKAGEERTVR
FQISEEDLKFYNTQLQWAAEPGEFNVQIGLDSQAVQQQRFELL
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagctgtgtttgctgggcctcgtcgtcagcctggccagtcagtcggcctttgcc
gatacccctgcagagccattgaagaacaaacaggcctttatcgccgacctcatgggccag
atgaccctggacgagaaaatcggccagttgcgcctgatcagcatcggcccggaaatgccc
cgcgagcagatccgcaaggaaatcgccgccggccgcatcggcggtaccttcaactcgatc
acccgtgccgaaaaccgtccgatgcaggacgcggcaggtcgcagccgcctgaagatcccg
atgttcttcgcctacgacgtgatccacggccaccgcacgattttcccgatcagcctggcg
ctggcctcgagctgggacatggacgccatcgccaaggtcggacgggtatccgccctcgaa
gcctccgccgacggtatcgacatgaccttcgcgccaatggtcgatatcgcccgcgaccca
cgctggggccgcaccagtgaaggctttggtgaagacacctacctggtctcgcggatttcc
aaagtcatggtcgagtccttccagggcaagagcccggccgaggcaaccagcctgatggcc
agcgtcaagcacttcgccctgtacggcgcggtggaaggcggccgcgactacaacacggtc
gacatgagcccgaccaagatgttcaacgactacctgcccccctaccgcgccgccatcgat
gccggcgccggtggggtgatggttgcgctgaactcgatcaacggcgtgccggccacctcc
aacacctggctgatgcatgacctgttgcgcaaggactggggcttcaagggcgtgaccgtc
agcgaccacggggcaatcaccgaactggtgcgccatggtgtcgcccgcgatggccgcgaa
gcggcgaagctggcgatcaaggccggcatcgacctgagcatgaacgactcgctgtacgat
tcagaactggccagcctgctcaaggccggcgaaatcaaccaggccgatatcgacaacgcc
gtgcgtgaagtgcttggcgccaagtacgacatgggcctgttcgccgacccgtaccgtcgc
atcggcaaggccagcgacgacccagccgatacctacgccgaaaaccgcctgcaccgtgcc
gaagcgcgtgacgtggcgcgccgcagcatggtgctgctggaaaaccgcgaacagaccctg
ccactgaaaaaggccggcaccatcgccctggtcgggccgctggccgatgcaccgatcgac
atgatgggcagctgggccgccgccggtcgtccacagcagtcggtgaccgtgcgcgaaggc
atgcgccaggtgctcggtgaccaggccaaggtgatctatgccaaaggctccaacgtcacc
cacgacaaggccatcctcgattacctgaacttcctcaacttcgatgcgccggaaatcgtc
gacgacccacgtccggctgcggtgctgatcgatgaagcggtcaaagcggccaagcagtcc
gatgtgatcgtcgccgtggtcggtgagtcgcgtggcatgtcgcacgaatcgtcgagccgc
accaccctggaaatcccggccgcccagcgcgagctgatcaaggccctgaaagccaccggc
aagccgctggtactggtgctgatgaacggccggccactgtcgctgagctgggaacgcgag
caggccgatgcgatcctggaaacctggttcaccggtaccgaaggcggtaatgccattgcc
gatgtgctgttcggcgattacaacccctcgggcaaactgccaatcaccttcccgcgctcg
gtcgggcagatcccgatgtactacaaccacctgagcattggccggcccttcaccccgggc
aagcctggcaactacacctcgcagtacttcgaagagcccaacggcccgctctatcctttc
ggctacggcctgagctacagcgagttcagcctgtcgccactgaccctgtcgagcaagacg
ctgaaaaagggccagaccctcgaagccagtatccgcgtgaaaaacaccggcaaacgtgat
ggcgaaaccgtggtgcagctgtacctgcaagacattgccgcgtccatgagccgcccgatc
aaggagttgaagaacttccagaaggtcatgctcaaggccggtgaagagcgcaccgtacgc
ttccagatcagtgaagaagacctgaagttctacaacacccaactgcaatgggcggccgag
cccggcgagttcaatgtccagatcgggcttgactcccaggcggtgcagcaacaacgtttc
gaactgctgtaa

DBGET integrated database retrieval system