KEGG   Pseudomonas alkylphenolica: PSAKL28_34340Help
Entry
PSAKL28_34340     CDS       T03238                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, prokaryotic type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00020  Citrate cycle (TCA cycle)
palk00480  Glutathione metabolism
palk01100  Metabolic pathways
palk01110  Biosynthesis of secondary metabolites
palk01120  Microbial metabolism in diverse environments
palk01200  Carbon metabolism
palk01210  2-Oxocarboxylic acid metabolism
palk01230  Biosynthesis of amino acids
Module
palk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
palk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSAKL28_34340
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSAKL28_34340
Enzymes [BR:palk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PSAKL28_34340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AIL62586
UniProt: A0A077FH74
Position
complement(3744260..3745516)
Genome map
AA seq 418 aa AA seqDB search
MGYQKIKVPAVGDKITVNADHSLNVPDNPIIPFIEGDGIGVDVSPVMIKVVDAAVEKAYG
GKRKISWMEVYAGEKATQVYDQDTWLPQETLDAVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVVWFQGVPSPVKKPGDVDMVIFRENSEDIYAGIEWKAGSPEATKVIKF
LKEEMGVTKIRFDQDCGIGIKPVSKEGTQRLVRKALQYVVDNDRKSLTIVHKGNIMKFTE
GAFKDWGYEIAKNEFGAELLDGGPWMKFKNPKTGREVIVKDAIADAMLQQILLRPAEYDV
IATLNLNGDYLSDALAAEVGGIGIAPGANLSDTVAMFEATHGTAPKYAGKDQVNPGSVIL
SAEMMLRHLGWTEAADLIIKGTNGAIAAKTVTYDFERLMDGATLVSSSGFGDALIKHM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggataccagaaaatcaaggttccggcagtcggcgacaaaatcaccgtcaatgcggac
cattctctcaatgttcctgataatccgatcatcccgttcatcgaaggcgacggcattggc
gtagacgtcagtcccgtcatgatcaaagtggtcgatgctgctgtagaaaaagcctatggg
ggcaagcgcaagatttcctggatggaagtctacgctggtgagaaggccacccaggtgtat
gaccaggatacctggctgccccaggaaaccctggacgcggtcaaggattacgtcgtctcc
atcaaaggtccgctgaccaccccggtcggtggaggtatccgctcccttaacgtggccctg
cgccaacaactggacctgtatgtctgtctgcgcccggtggtgtggttccagggtgtgccg
agcccggtgaaaaagccgggtgacgtcgacatggtgatcttccgcgaaaactccgaagac
atttatgccggtatcgaatggaaggccggctcgcctgaggcgaccaaggtcatcaagttc
ctgaaagaagaaatgggtgtcaccaagatccgtttcgaccaggattgcggcatcggcatc
aagccggtatcgaaggaaggcacccagcgcctggtgcgcaaggctctgcagtacgtagtg
gacaacgaccgcaagtcgctgaccatcgtgcacaagggcaacatcatgaagttcaccgaa
ggtgccttcaaggactggggctacgagatcgccaagaacgaattcggcgccgagctgctc
gacggcggcccatggatgaagttcaaaaacccgaaaaccggccgtgaagtcatcgtcaag
gatgctatcgctgacgccatgctccagcagatcctgctgcgtccggccgaatatgacgtg
attgccacccttaacctcaacggtgactacctctccgatgctctggcggcagaagtgggt
ggtatcggtattgcgccgggcgctaacctgtccgacaccgtggccatgttcgaagccacc
cacggtaccgcgccgaaatacgccggcaaggaccaggtcaacccaggctcggtgattctc
tcggccgagatgatgctgcgccacctgggctggaccgaggcggctgacctgatcatcaag
ggtaccaacggtgccatcgcggctaaaaccgtgacttatgacttcgagcgcctgatggat
ggcgcgacgctggtcagcagctccggttttggtgatgcgctgatcaaacacatgtaa

DBGET integrated database retrieval system