KEGG   Pseudomonas alkylphenolica: PSAKL28_38420Help
Entry
PSAKL28_38420     CDS       T03238                                 

Definition
(GenBank) PHP family phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
palk  Pseudomonas alkylphenolica
Brite
KEGG Orthology (KO) [BR:palk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSAKL28_38420
Enzymes [BR:palk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     PSAKL28_38420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AIL62992
UniProt: A0A077FC96
Position
complement(4214427..4215290)
Genome map
AA seq 287 aa AA seqDB search
MNVDLHCHSTASDGALSPTALVARAHEHGVRMLSLTDHDTLEGQLEARAAAQALDMQWVS
GIELSCTWGGATIHVLGYNFALDAAPLLDAVESLHRGRWLRSEEIDRRLAAKGMPGALEG
ARAIQQELGDSGNAPARPHFAEFLVRAGHVKDRAEAFRKWLGAGKLGDVKLHWPTLDETV
ETLRKSNAWVSLAHPMHYELTRSKRRRLIADYIQAGGQALEVVNGMMPAEQVGTMSILAR
EFGLLASAGSDFHGPGTWGEIGAYRPLPEDLPPLWRRFKHEQPNAAV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgatctgcactgccacagtacggcctccgatggcgccctgtcgccgacggca
ctggtcgcccgggcccatgagcacggcgtgcggatgctctcgctgactgaccacgacacc
cttgaagggcaacttgaggcccgcgccgctgcacaggcgctggacatgcagtgggtcagc
gggatcgagttgtcgtgcacctggggcggcgcgaccatccatgtattgggctacaacttt
gccctggacgctgcgcctttgctcgacgccgtcgaatcgttgcaccgcgggcgctggttg
cgctccgaagaaatcgaccggcggttggcagccaaaggcatgccgggcgcgttggagggc
gcacgggccatccagcaggagctgggcgacagcggcaacgccccggcacgtccgcacttt
gccgagttcctggtgcgtgcaggccacgtcaaagaccgcgccgaggcctttcgcaagtgg
ttgggcgccggcaagctgggtgacgtcaagctgcactggccaaccctcgacgagaccgtg
gaaaccctgcgcaaatccaatgcctgggtcagcctggcgcacccgatgcactatgaatta
acacgcagcaagcgccgccggctgattgccgactatattcaagcaggcggccaggcgctg
gaagtggtcaacggcatgatgccggccgaacaggtgggcaccatgtccatcctggcccgt
gaattcggcctgctggccagtgccggcagtgacttccatggccctggcacctggggtgag
atcggtgcttaccggccattgccagaggacctgccacctttgtggcgtcgattcaaacat
gaacagccaaacgcggccgtctga

DBGET integrated database retrieval system