KEGG   Pseudomonas alkylphenolica: PSAKL28_45620Help
Entry
PSAKL28_45620     CDS       T03238                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00020  Citrate cycle (TCA cycle)
palk00620  Pyruvate metabolism
palk01100  Metabolic pathways
palk01110  Biosynthesis of secondary metabolites
palk01120  Microbial metabolism in diverse environments
palk01130  Biosynthesis of antibiotics
palk01200  Carbon metabolism
Module
palk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
palk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSAKL28_45620
   00620 Pyruvate metabolism
    PSAKL28_45620
Enzymes [BR:palk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PSAKL28_45620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIL63702
UniProt: A0A077FDX5
Position
4970075..4971580
Genome map
AA seq 501 aa AA seqDB search
MAQNEAVDVVLVGAGIMSATLAVLLKELDPAIKLEVVELMDSGAAESSNPWNNAGTGHAG
LCELNYTPQAADGSIDIKKAVHINTQFEVSRQFWAYLSKKGAFSSPRAFINPVPHLSYVE
GDKGVDFLKKRFDLLKQHHAFSEMEYTEDKALMNEWMPLMMPGRPADQKIAATRVMKGTD
VNFGTLTNKLLKHLASAPDAQVKYCKRVTGLRRNGSGWTVSIKDVNSGSSRDVNARFVFL
GAGGAALPLLQQSGIEESKGFGGFPVSGQWLRCDNPEVVKKHQAKVYSQAAVGSPPMSVP
HLDTRVVDGKTSLLFGPYAGFTTKFLKHGSFLDLPLSVRMSNIGPMLAVARDNMDLTKYL
VSEVMQSMEQRLDSLRRFYPEAKAEDWRLEVAGQRVQIIKKDPKKGGILQFGTELVAAKD
GTLAALLGASPGASVTVSIMLELIERCFPEQTKGAWAAKLKEIFPAREKILAADAALYHK
ISAHNDEVLGLVENSPAQHYA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaacgaagcagtcgatgtagtactggtaggggcaggcatcatgagtgccacc
ctggccgtactgctcaaggaactcgacccggcgatcaagctggaagtcgtcgagttgatg
gattcgggtgccgcggaaagttccaacccgtggaacaacgccgggaccggccatgccgga
ctgtgtgaactgaactacacgccgcaggctgccgacggcagcatcgacatcaagaaagcg
gtgcacatcaacacccagttcgaggtgtcccggcagttctgggcctacctgagcaagaaa
ggcgcgttcagctcgccacgggcgttcatcaacccggtgccgcacctgagctacgtcgaa
ggcgacaaaggtgtcgatttcctcaagaagcgcttcgatctgctcaagcagcatcacgcc
ttcagcgagatggaatacaccgaagacaaagcgctgatgaacgagtggatgccgctgatg
atgccgggtcgccctgccgaccagaaaatcgccgccacccgcgtcatgaaaggcaccgac
gtcaacttcggtaccctgaccaacaaactgctcaagcacctggccagcgcgccggatgcc
caggtcaagtactgcaagcgggtcactggcctgcgccgtaacggcagtggctggaccgtc
agcatcaaggacgtcaacagcggcagcagccgcgacgtcaacgcccgcttcgtcttcctc
ggcgccggtggcgcggccctgccgctgctgcagcagtcgggcatcgaagagagcaaaggc
tttggcggcttcccggtcagcggccaatggctgcgctgcgacaacccggaagtggtcaag
aagcaccaggccaaggtttacagccaggccgcggttggttcgccgccgatgtcggtgccg
cacctggacacccgcgtcgtcgacggcaagacctcgctgctgttcggcccatatgccggc
tttaccaccaagttcctcaagcatggctcgttcctcgacctgccgctgtcggtacgcatg
agcaacatcggcccgatgctcgccgtggcccgcgacaacatggacctgaccaagtacctg
gtcagcgaagtgatgcagtcgatggagcagcgtctggactcgctgcgtcgcttttacccc
gaggcgaaagccgaggactggcgcctggaagtggccggtcagcgcgtgcagatcatcaag
aaagacccgaaaaaaggcggcatcctgcagttcggtaccgaactggtagcagccaaagac
ggcaccctggccgctctgctgggcgcctctcctggtgcttcggtgacggtatcgatcatg
cttgagctgatcgagcgctgcttccccgagcaaaccaagggtgcctgggcggccaagctc
aaggaaattttcccggcccgggaaaagatcctggccgcagacgctgcgctgtatcacaag
atcagcgcgcacaacgacgaggtcctgggcctggtcgaaaacagcccggcgcagcactac
gcgtaa

DBGET integrated database retrieval system