KEGG   Pseudomonas alcaliphila: UYA_07085
Entry
UYA_07085         CDS       T06680                                 

Definition
(GenBank) bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
pall  Pseudomonas alcaliphila
Pathway
pall00621  Dioxin degradation
pall01100  Metabolic pathways
pall01120  Microbial metabolism in diverse environments
pall01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pall00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    UYA_07085
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: APU29503
UniProt: A0A1L7FXF6
Position
complement(1554169..1554465)
AA seq 98 aa
MPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDVVECSLHMGKFC
VRTGKVKSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP
NT seq 297 nt   +upstreamnt  +downstreamnt
gtgcccgaaggcgaagccctgaaggtcgaaagtggaggcacctccgtcgcgattttcaat
gtggatggcgagctgttcgcaacacaggaccgctgcacccacggcgactggtccctgtcc
gatggcggctatcttgaaggtgacgtggtggaatgctcactgcacatggggaagttttgc
gttcgcacgggcaaggtcaaatcaccgccgccctgtgaggcactgaagatatttccgatc
cgcatcgaagacaatgacgtgctggtcgacttcgaagccgggtatctggcgccatga

DBGET integrated database retrieval system