KEGG   Pseudoalteromonas aliena: B0W48_04180Help
Entry
B0W48_04180       CDS       T04815                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:paln00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0W48_04180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paln01007]
    B0W48_04180
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paln03016]
    B0W48_04180
   03029 Mitochondrial biogenesis [BR:paln03029]
    B0W48_04180
Enzymes [BR:paln01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     B0W48_04180
Amino acid related enzymes [BR:paln01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   B0W48_04180
Transfer RNA biogenesis [BR:paln03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B0W48_04180
 Prokaryotic type
   Other AARSs
    B0W48_04180
Mitochondrial biogenesis [BR:paln03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B0W48_04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1 tRNA-synt_1e tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: AQP99071
UniProt: A0A1Q2GVC5
Position
complement(951112..952854)
Genome map
AA seq 580 aa AA seqDB search
MNIRTILIEKAIAAMAGAGLPEDTNPAVTQSTRPQFGDYQINAAMGAAKKMKSNPRELAQ
KIIDNLDVSDIAQKTEIAGPGFINIHLKPEFLAQSVKAANSDAKLAVNEHANPQKVVVDY
SSPNLAKEMHVGHLRSTIIGDSIVRALEFRGDTVVRQNHMGDWGTQFGMLIAHLEDQISQ
GVDLDSVALADLETFYRDAKKRFDDEEGFADKARDYVVKLQGGDAHCEKLWKLFIATSVK
HSEEVYKRLNVTLTQADIMAESAYNAELNDIISLLKDKNIAVESQGAQVVFLEELANKDG
EPSAFIVQKSGGGFLYATTDLAACDYRSNKLGADRILIFVDARQSLHFNQVELTARKAGL
LRDETSYEFCPFGTMMGADNKPFKTRTGGTVKLADLLEESINRAATKLAERESDLSDSER
SEIARKVGIGAVKYADLSKHRTSDYIFNWDSMLSFEGATAPYLQYAYTRIRSIFRKSGVD
AATLNSDVTIVEPQEKALALKLLQLEEVLDLMISEATPHVLCGYLYELASLYMTFYEACP
VLKEGVEPSVRDSRLVLCNLVSKTLEKGLDLLGIEVMEQM
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgtactattttaatcgaaaaagccattgctgctatggcgggtgcaggctta
cccgaagatacaaacccagcagtaacacaaagcacacgtccacaatttggtgattaccaa
attaatgcagcaatgggcgcggctaaaaaaatgaaaagcaacccacgtgagcttgcgcaa
aaaattatagataatcttgatgtaagcgatattgctcaaaagactgaaattgcgggtcct
ggttttattaatattcatttaaaacctgagtttttagctcaaagcgttaaagcagctaac
agtgatgcaaagcttgctgtaaacgagcatgctaacccgcaaaaagtggttgttgactat
tcatcaccaaaccttgctaaagaaatgcacgtaggccatttacgttcaacaattattgga
gactcaattgtacgtgcgcttgaatttagaggcgacacggttgtacgtcaaaatcacatg
ggtgattggggcacacaatttggtatgttaatcgcgcatttagaagatcaaattagccaa
ggcgtagatttagattctgtagcacttgctgatttagaaacgttttaccgcgacgctaaa
aaacgctttgacgacgaagaaggctttgcagataaagcacgtgactacgttgttaaatta
caaggtggcgatgcgcattgtgaaaaactgtggaaactatttatagcaacctcagttaag
cactctgaagaagtatacaaacgtttaaatgtaacgcttactcaagccgatattatggct
gaaagcgcatacaacgcagaacttaacgatattattagcctacttaaagataaaaacatt
gctgtagagtcacaaggcgcgcaagttgtatttttagaagagctagctaacaaagatggc
gagccatcagcgtttatcgtacaaaaatctggcggtggttttttatatgcaactaccgat
ttagcagcatgtgattaccgttcaaataaattaggtgctgatcgtatcttaatttttgta
gatgcacgtcaaagtctacactttaatcaagtagagctaacagcgcgtaaagcgggttta
ttacgagacgaaacaagttacgagttttgcccgtttggcaccatgatgggcgccgataac
aaaccatttaaaacacgtactggcggcacagtaaaacttgctgacttattagaagaatca
attaaccgtgccgcaacaaaactagctgaacgtgagtctgatttaagtgattctgagcgc
agcgaaattgcacgtaaagtaggtattggcgcagttaaatacgctgacctttctaagcac
cgtaccagcgattacatttttaactgggacagcatgctaagctttgaaggcgcaaccgct
ccttacttacaatatgcttatacacgtatacgcagtattttccgtaagtcaggcgttgat
gcagctacattaaattcagacgttacaattgttgagcctcaagaaaaagcgctagcactt
aagctactacagcttgaagaagtacttgatttaatgatcagtgaagcaacaccgcacgta
ctatgtggttacttatatgagctagcaagcttatacatgacattttacgaagcctgccca
gtacttaaagaaggcgtagagccaagcgttcgcgatagccgtttagtgctgtgtaatttg
gtttctaaaacattagagaaagggctagatctgctaggtattgaagttatggagcaaatg
taa

DBGET integrated database retrieval system