KEGG   Pseudoalteromonas aliena: B0W48_08640Help
Entry
B0W48_08640       CDS       T04815                                 

Definition
(GenBank) dihydromonapterin reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00670  One carbon pool by folate
paln00790  Folate biosynthesis
paln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B0W48_08640
   00670 One carbon pool by folate
    B0W48_08640
Enzymes [BR:paln01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     B0W48_08640
    1.5.1.50  dihydromonapterin reductase
     B0W48_08640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA
Motif
Other DBs
NCBI-ProteinID: AQP99851
UniProt: A0A1Q2GXI7
Position
complement(1945619..1946338)
Genome map
AA seq 239 aa AA seqDB search
MTSPILITGAGQRIGLALAQHYIAQGQDVIITYRTRHDAVDKLEQQGVVCIYADFSTDAG
INTFIETLNTCTLSLRAIVHNASSWDCEANNPDYAALFDNMMRIHAKTPYLINMMCAELL
LAHQKVTGTPADIIHLTDYVVETGSPKHLAYAASKAALENLTKSFSAKYAPNIKVNSVAP
SLIIFNEHDDEQYRVKTLKKSLMGIEPGCQEIINSIDLLLQSHYITGRSLPIDGGRHLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcccattttaattaccggcgcaggccaacgtattggtttagcgctagctcag
cattatatagcccaaggacaagacgttataattacataccgtactcgccatgatgcggtt
gataaactcgagcagcaaggtgtggtgtgtatttatgctgactttagtaccgatgcagga
attaatacatttatagagacgcttaatacatgcacgctgtcattacgcgcaattgtgcat
aatgcatcaagctgggattgtgaggcgaataatcctgactacgccgcactgtttgacaac
atgatgcgtatacacgctaaaacaccgtatttaatcaatatgatgtgcgcagagcttctt
ttagcgcaccaaaaggtaacggggactccggccgatatcattcaccttactgactacgta
gttgaaacaggcagccctaagcatttagcttacgcggcaagtaaagcagcccttgaaaac
ctaactaaatcgttcagcgctaaatatgcgccaaatataaaagtaaactcggtggctccc
tcactcattatttttaatgagcatgacgatgagcaataccgtgtaaaaaccctaaaaaaa
tcattaatgggcattgaaccaggatgccaagaaattatcaatagcattgatttactgctg
caaagccattacatcaccgggcgctctttgcctattgatggtggtcgtcacttaaagtaa

DBGET integrated database retrieval system