KEGG   Pseudoalteromonas aliena: B0W48_09025Help
Entry
B0W48_09025       CDS       T04815                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00471  D-Glutamine and D-glutamate metabolism
paln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B0W48_09025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paln01011]
    B0W48_09025
Enzymes [BR:paln01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     B0W48_09025
Peptidoglycan biosynthesis and degradation proteins [BR:paln01011]
 Precursor biosynthesis
  Racemase
   B0W48_09025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race AAA_26
Motif
Other DBs
NCBI-ProteinID: AQP99920
UniProt: A0A1Q2GY30
Position
2030368..2031162
Genome map
AA seq 264 aa AA seqDB search
MSVHIMVFDSGIGGTTVLEHIQQSIPHAQYSYFMDNALLPYGAQSQQTIINRLCALVHFI
KQEDLDVDLIVIACNTASTSALSAVRQITDIPIVGVVPAIKPAAQLSQSKHIGLLATPTT
VSSSYTAKLIQEHARHITVNLYSSVRLVSLAEQYFFTQQLDTGELYKELDSLEINKEVDV
LVLGCTHFPILAKPINAYFNSKVQLLDSGAAIANRVSDLLSSYCGLNKKASDTKKPLQYY
ATADIFSTKLVVKLVTLIDQVQDV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtgcacattatggtttttgattcaggtattggtggcactaccgtacttgagcat
attcagcagagcatacctcatgctcaatacagttattttatggataatgctttactgcca
tatggtgctcaatcacaacaaactatcatcaatcgtttatgcgcccttgtacatttcatc
aaacaagaagacctcgacgtcgatttaattgttatagcctgcaataccgcatccacgtca
gcgttgagtgcggtacgtcaaattactgatattccaattgtaggcgttgtacctgcaata
aagccggcggctcaattaagtcaatcaaaacatatcgggcttcttgccacgcctacaact
gtatcaagttcatatacggctaaactcattcaagaacatgccaggcatataacggttaac
ttatatagtagtgttaggttggtgtcgctggcagagcagtacttttttactcaacaacta
gatacaggtgagctttataaagagctggatagtttagagatcaataaagaagttgatgtg
ttggtgctagggtgtacacattttcctattttagctaaaccaataaacgcgtattttaat
tcaaaagtacagttgcttgattctggtgctgcaatagccaatcgtgttagtgatttactt
agtagttactgtgggttgaataaaaaagcttcggatacaaaaaagccgctgcaatattat
gcaacggctgatatttttagtactaagctagtagtaaagctggttacgctgattgatcaa
gttcaggacgtatag

DBGET integrated database retrieval system