KEGG   Pseudoalteromonas aliena: B0W48_09215Help
Entry
B0W48_09215       CDS       T04815                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
paln  Pseudoalteromonas aliena
Pathway
paln03010  Ribosome
Brite
KEGG Orthology (KO) [BR:paln00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B0W48_09215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:paln03011]
    B0W48_09215
Ribosome [BR:paln03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B0W48_09215
  Bacteria
    B0W48_09215
  Archaea
    B0W48_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: AQP99946
UniProt: A0A1Q2GXY1
Position
2068059..2068391
Genome map
AA seq 110 aa AA seqDB search
MQALAKHKFASGSAQKARLVADQIRGLPVDRALEILAYSPKKAAVLVKKVLESAIANAEH
NEGADIDELRITTIFVDDGPTMKRIMPRAKGRADRILKRTSHITVMVSDS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattagctaaacataaattcgcctctggttcggcgcaaaaagcacgtctagtt
gcagatcagatccgcggattacctgtcgatcgcgcactagaaatcctggcgtacagccct
aaaaaagcggctgtattagttaagaaagtacttgagtctgctattgctaacgcagagcat
aacgaaggtgctgacattgatgagcttcgtataactacgatctttgtggacgatggtcct
acaatgaaacgtattatgcctcgtgctaaaggacgcgcagaccgcatccttaagcgtaca
agccatatcactgttatggtttcagatagctag

DBGET integrated database retrieval system