KEGG   Pseudoalteromonas aliena: B0W48_09890Help
Entry
B0W48_09890       CDS       T04815                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00230  Purine metabolism
paln00250  Alanine, aspartate and glutamate metabolism
paln01100  Metabolic pathways
Module
paln_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:paln00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B0W48_09890
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B0W48_09890
Enzymes [BR:paln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     B0W48_09890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AQQ00072
UniProt: A0A1Q2GY61
Position
2217329..2218642
Genome map
AA seq 437 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKVVDLLTDKASLVVRYQGGHNAGHTLVIEGEKTVLHLIPSGV
LRDNVKCVIGNGVVLSPEALMREIGMLEERGVPVRERLLISEACPLILPFHVALDVARET
ARGDKPIGTTGRGIGPAYEDKVARRGLRVGDLFNPELFAAKLKEVLEYHNFTLVNYYKVD
AVDFQKTFDDAMAVADILKAMVVDVTELLDQTRLAGENILFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGAGFGPLNLDYVLGIIKAYTTRVGSGPFPTELYDGLDKQDPVGKHLGDK
GHEFGATTGRLRRTGWLDAVAMRRAVQINSISGFCLTKLDVLDGLETLKICTGYKLEDGT
VTNVTPLAAEGYDKVTPVYEEMPGWSENTVGVTTLEGLPKAAIDYIKRIEEITGVPIDII
STGPDRVETMVLRNPFV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaacgttgttgtattaggcacccaatggggtgacgaaggaaagggtaaggta
gttgatctccttacagacaaagcatctttagtagttcgttatcaaggtggccacaatgcg
ggtcatactttagttatcgaaggtgaaaagacggttctacaccttattccatcgggtgta
ttacgtgacaatgttaaatgtgtgattggtaatggtgtagttttatcgccagaagcgcta
atgagagaaattggcatgcttgaagaacgtggcgtaccagtacgcgagcgtcttcttata
agcgaagcatgtccgctaatcttgcctttccatgttgcattagatgtagcccgtgaaact
gcacgtggcgataagccaattggtacgactggtcgtggtatcggtcctgcgtacgaagat
aaagttgcgcgccgtggtttacgcgtaggcgatttatttaatcctgaattatttgcagct
aaattaaaagaagttcttgagtaccataacttcactttagttaactactacaaagtagac
gctgtagatttccaaaaaacgtttgatgatgcaatggctgttgctgatatcttaaaagca
atggttgtcgatgtaactgagcttttagatcaaacgcgtttagcaggcgaaaatattttg
tttgaaggtgcacaaggtacattacttgatattgatcatggtacttacccttatgtaaca
tcttcaaacactaccgctggtggcgttgctactggtgctggttttggccctttaaacctt
gattacgttttaggtattattaaagcgtacacgacacgtgttggttcaggccctttccct
acagagctttacgatggtcttgataaacaagatccagtaggtaagcacttaggcgataaa
ggtcatgaatttggcgcaacaacaggtcgacttcgtcgtactggttggttagatgcagtc
gctatgcgtcgtgcggttcaaatcaacagtatctcaggtttttgtttaactaagcttgat
gttttagatggcttagaaacacttaaaatctgtactggttataagcttgaagatggcaca
gttactaacgtaacgccattagcagctgaaggttacgataaagtaacgccagtatacgaa
gaaatgccaggttggtcagagaacactgttggtgtaactacacttgaaggcttaccaaaa
gctgcgattgactacatcaagcgtattgaagaaattactggtgttccaattgatattatt
tctacaggtccagatcgcgtagaaactatggtacttcgcaacccgtttgtgtaa

DBGET integrated database retrieval system