KEGG   Pantoea ananatis LMG 20103: PANA_0077Help
Entry
PANA_0077         CDS       T01195                                 

Gene name
tkrA
Definition
(GenBank) TkrA
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00030  Pentose phosphate pathway
pam00260  Glycine, serine and threonine metabolism
pam00620  Pyruvate metabolism
pam00630  Glyoxylate and dicarboxylate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_0077 (tkrA)
   00620 Pyruvate metabolism
    PANA_0077 (tkrA)
   00630 Glyoxylate and dicarboxylate metabolism
    PANA_0077 (tkrA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_0077 (tkrA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     PANA_0077 (tkrA)
    1.1.1.81  hydroxypyruvate reductase
     PANA_0077 (tkrA)
    1.1.1.215  gluconate 2-dehydrogenase
     PANA_0077 (tkrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN
Motif
Other DBs
NCBI-ProteinID: ADD75244
UniProt: D4GFY0
Position
81956..82930
Genome map
AA seq 324 aa AA seqDB search
MKPAVILYKKLPDDLRARLAEHATVTEMKDLSPESQQQHEKALQEAEGLLGSGGKVNRDL
LAKMPRLRACSSVSVGYDNFDVDALNQRGVVLMHTPTVLTETVADTIMALVLSSARRIPE
LDAWVKAGNWQKSIGPAHFGIDVHHKTLGILGMGRIGMALAQRAHFGFGMKIIYQARRQH
AQAESQFAAERCELETLLKQSDFVCISLPLTEETYHLIGAEQLKLMKSSAVLINAGRGPV
VDENALIAALQEGTIHAAGLDVFEKEPLPTDSPLLSLPNVVTLPHIGSATHETRYGMMQD
AVENLIAALNGNVEKNCVNPHVLT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgccgtcattctatacaaaaaattgcctgacgatctgcgtgcgcgtcttgct
gaacatgccacggtgactgaaatgaaggatctgtcgccagaaagccagcagcagcacgaa
aaagcgctacaggaggcagaaggattactgggctcgggcggcaaagttaatcgcgatctg
ttggcaaaaatgcccagactgcgggcctgctcaagcgtgtctgtgggctatgacaacttt
gatgtggatgcgttaaatcaacgaggcgtggtgctgatgcacacgccgacggtgctgact
gaaacggtcgccgacaccatcatggcgctggtgctcagcagcgcgcgccgcattccggag
ctggatgcctgggtcaaggctggcaactggcaaaaaagcatcggaccggcgcattttggt
attgatgtacaccacaaaacgttgggcattctggggatgggccgcataggcatggcgctg
gcccagcgggcgcatttcggttttggcatgaaaattatttatcaggctcgccgccagcac
gcgcaggctgagtcacagttcgccgcagaacggtgtgaactggaaacgctattgaaacag
agcgactttgtatgcatcagcctgccgctgactgaagagacttaccatttgatcggcgcg
gaacagctgaaactgatgaaatccagtgcggtactgatcaatgccggccgtgggccagtg
gtggatgaaaacgccctgattgccgccctgcaggagggcactattcacgccgccgggctg
gatgtcttcgaaaaagagcctttacccactgactcgccgctgctgtcgttaccgaatgtt
gtgacgctgccgcacattggttcagcgacccacgaaacccgatacggaatgatgcaggat
gcggttgaaaacctgattgcagcccttaacggcaatgtagagaaaaactgcgttaatccg
catgtcctgacgtaa

DBGET integrated database retrieval system