KEGG   Pantoea ananatis LMG 20103: PANA_0200Help
Entry
PANA_0200         CDS       T01195                                 

Gene name
fadA
Definition
(GenBank) FadA
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00071  Fatty acid degradation
pam00280  Valine, leucine and isoleucine degradation
pam00281  Geraniol degradation
pam00362  Benzoate degradation
pam00592  alpha-Linolenic acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01212  Fatty acid metabolism
Module
pam_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PANA_0200 (fadA)
   00592 alpha-Linolenic acid metabolism
    PANA_0200 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA_0200 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    PANA_0200 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PANA_0200 (fadA)
   00642 Ethylbenzene degradation
    PANA_0200 (fadA)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     PANA_0200 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADD75367
UniProt: D4GGR6
Position
complement(227056..228219)
Genome map
AA seq 387 aa AA seqDB search
MENVVIIDAVRTPMGRSKGGAFRHVRAEDLSAHVMRELLSRHPAVNAATLDDIVWGCVQQ
TLEQGFNIARNAALLAEIPHVVPATTVNRLCGSSMQALHDAARAIMVGDAHACLIGGVEH
MGHVPMNHGVDFHPGLGRTVAKAAGMMGLTAEMLARMHHISREQQDAFALRSHQRAWQAT
QRGDFANEIVAIHGHDADGALKRYDFDEVIREDTSLEGLAALRPAFDPVTGTVTAGTSSA
LSDGAAAMLIMSESRARELGLKPRARIKSMAVVGCDPSIMGYGPVPASKLALKRAGLSVN
DIDIFELNEAFAAQVLPCIKDLGLSDKLDEKVNLNGGAIALGHPLGCSGARISTTLLNIM
ERRDAQFGLASMCIGLGQGIATVIERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgtagtcattattgacgcagtgcgcacgccaatgggccgctcgaaaggcggt
gcctttcgtcacgtacgtgcagaagacctgtcagcgcacgttatgcgtgaactgttaagt
cggcatccggcagtcaatgctgccaccctggatgacatcgtctggggctgcgtacagcaa
acgctggagcaaggctttaatattgcccgcaacgccgcgctgctggccgaaatcccgcat
gtcgtacccgccacaacggtcaaccgtctgtgtggatcctcaatgcaggccctacacgat
gccgcacgcgccattatggtgggagatgcacatgcctgtttgatcggtggtgtggagcac
atgggacatgtccccatgaaccatggcgttgattttcatcccggcttagggcgtaccgtt
gcgaaagcggcaggaatgatgggattaaccgcagagatgctggcgcgcatgcaccacatc
agccgcgagcagcaggatgcattcgctttgcgctcccatcagcgcgcctggcaggcgaca
cagcgcggcgatttcgcaaatgaaattgttgcgatacacggccacgacgccgacggcgcg
ctgaaacgctatgactttgatgaagtgatccgtgaagataccagcctggaaggccttgcg
gcactgcgacctgcatttgatcccgtgaccgggacggtgaccgcaggcacatcctcagcc
ctgtcagatggggcagccgccatgctgattatgagtgaaagccgcgcacgggagctgggg
ctgaaaccccgcgcccgtattaaaagtatggcggtggtgggctgcgatccctcaatcatg
ggctacggtccggtgcccgccagcaagctggcgttgaagcgcgctgggctgagcgtgaac
gacattgacatcttcgagctcaacgaagcctttgcagcgcaggttctgccctgcattaag
gatttgggactgtcagacaaactggatgagaaggtgaacttaaatggcggcgccatcgca
ttgggtcatccactgggatgttcaggcgcacgcatcagtacgacgttgctgaatattatg
gaacgccgcgatgcgcagtttggtctggcgtcaatgtgtattggcctgggtcagggcatc
gccaccgttatcgaacgcgtttga

KEGG   Pantoea ananatis LMG 20103: PANA_2694Help
Entry
PANA_2694         CDS       T01195                                 

Gene name
fadI
Definition
(GenBank) FadI
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00071  Fatty acid degradation
pam00280  Valine, leucine and isoleucine degradation
pam00281  Geraniol degradation
pam00362  Benzoate degradation
pam00592  alpha-Linolenic acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01212  Fatty acid metabolism
Module
pam_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PANA_2694 (fadI)
   00592 alpha-Linolenic acid metabolism
    PANA_2694 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA_2694 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    PANA_2694 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PANA_2694 (fadI)
   00642 Ethylbenzene degradation
    PANA_2694 (fadI)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     PANA_2694 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADD77861
UniProt: D4GJB1
Position
complement(3033215..3034534)
Genome map
AA seq 439 aa AA seqDB search
MDTMSKAQSLLTRNGERIAITHGLRTPFLRQATGFHGIPAVELGRMVISEIMARSELPVE
VIEQLVFGQVVQMPEAPNIAREIVLSSGLSVNTDAYSVSRACATSFQAVANVTESLLAGT
ISAGIAGGADSSSVLPIGVSKTLARALVDMNKARGFSQKLHILRRLRPKDLLPVPPAVAE
YSTGLRMGDTAEQMAKTHGISREEQDALALRSHQRAAQAWQSGVLRQEVMAAFVPPWKAP
IEQDNNVRMDAKAADYARLRPAFDRQHGTVTAANSTPLTDGAAAVILMREGRAKELGIQP
LGYLRSYAFTAIDVWQDMLLGPAYASPLALDRAGIALKDLTLIDMHEAFAAQTLSNLKMF
RDERFARDVLNRAHALGEVDEARFNVSGGSIAFGHPFAATGARMITQTLNELRRRGGGLG
LVTACAAGGLGAAMVLEAE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtggatacaatgagcaaagcgcagtcactgctgacgcgtaatggcgagcgcatcgccatc
acccacggattacgtacgccttttcttcgccaggccacgggttttcacggcatccctgcg
gttgaactgggtcgcatggtgatcagcgaaatcatggcccgaagtgaactcccggttgag
gtgattgagcaactggtcttcggtcaggtggtgcaaatgccggaagcgccaaacattgca
cgcgagatcgtcttaagcagtggcctgagcgtcaataccgatgcttatagcgtcagccgc
gcctgcgccaccagctttcaggcggtggcaaacgtcaccgaaagcttactggcaggtacg
atttctgccggcatcgcaggcggggcggactcctcctctgtgctgcccattggggtcagt
aaaacgctggcgcgcgcgctggtggatatgaataaagcgcgtggcttttcacagaagctg
cacattctccggcggctgcgccctaaagatctgttaccggttccgcctgccgttgcggag
tactccacaggattacgtatgggggataccgcagagcagatggccaaaacgcatggcatc
agccgggaagagcaggatgcattggccctgcgctcgcatcagcgcgcggcccaggcctgg
cagtcaggcgtactgagacaggaggtgatggccgcctttgtgccgccgtggaaagcgccc
atcgagcaagataataatgtgcgtatggatgcaaaagccgccgactatgcccggctgcgt
ccggcatttgaccgtcagcacggtaccgttacggcggcaaacagtacgccgcttaccgat
ggggctgcggcggtcattttaatgcgtgaaggccgggcaaaagagcttggaatacagccg
ctgggctatttacgcagctatgcgtttaccgctatcgacgtctggcaggacatgctgtta
gggccggcctacgcctcgccgctggcgctggatcgtgccgggatagccttaaaggatttg
acgctgattgatatgcacgaagcctttgccgctcagacgttaagcaacctgaaaatgttt
cgtgatgaacgttttgcccgggacgtgttaaaccgcgcccatgcgctgggcgaagttgac
gaggcacgttttaatgtctcgggcggatcgatcgcctttgggcatccgtttgccgcaacc
ggcgcacgcatgattacccagacgttaaatgaattacgccgccggggcggcgggctgggt
ttagtcacagcctgcgccgccgggggtttaggggcagcaatggttctggaggccgaataa

DBGET integrated database retrieval system