KEGG   Pantoea ananatis LMG 20103: PANA_0222Help
Entry
PANA_0222         CDS       T01195                                 

Gene name
hemE
Definition
(GenBank) HemE
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00860  Porphyrin and chlorophyll metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Module
pam_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PANA_0222 (hemE)
Enzymes [BR:pam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     PANA_0222 (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: URO-D
Motif
Other DBs
NCBI-ProteinID: ADD75389
UniProt: D4GH74
Position
265427..266497
Genome map
AA seq 356 aa AA seqDB search
MSELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGDFMSLCKNAELACEVT
LQPLRRFKLDAAILFSDILTIPDAMGLGLYFETGEGPCFSNPITCRADVDRLPVPDPEQE
LGYVMNAVRTIRKNLNGEVPLIGFSGSPWTLATYMVEGGSSKAFTKIKKMMYAEPATLHA
MLDKLADSVILYLNAQIRAGAQSVMVFDTWGGVLTGNDYREFSLYYMHKIVDSVLHENEG
RRVPITLFTKNGGQWLEAIAETGCDALGLDWTIDISEARRRVGHKVALQGNMDPSMLYAP
PARIEQEVATILEGFGQGEGHVFNLGHGIHQDVPPEHAGVFVEAVHRLSRQYHSAS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgaagaacgaccgttatttgcgcgccctgttacgccagcctgtagatgtc
acccccgtatggatgatgcggcaagccgggcgttatttgccggaatataaagcgacgcgc
gcccaggcaggcgattttatgtcgctgtgcaaaaatgccgaactggcctgcgaagtcacc
ctgcaacccctgcgtcgctttaagctggatgcggcgatcctcttcagtgatattctcacc
atccctgatgcgatggggctgggtttatacttcgaaacaggcgaaggcccgtgcttctcc
aacccgattacctgccgtgctgatgtcgatcgcctgccggtgcccgatcctgaacaggag
ctgggttacgtgatgaatgcggtacgcaccatccgtaaaaacctcaacggcgaagtacca
ttgattggcttctcaggcagcccctggacgctggcgacctatatggttgaagggggaagc
agcaaagccttcactaagatcaaaaaaatgatgtatgccgagcctgccacgctgcacgcc
atgctggataagctggccgacagtgtcatcctctatcttaatgcccagatccgcgccggt
gcgcagtcggtgatggtctttgacacctggggcggcgtgttaaccgggaacgactatcgt
gagttctcgctttactacatgcataaaattgtcgacagcgtgcttcatgagaacgaaggc
cgtcgtgtacccatcaccttgtttaccaagaatggtggtcagtggctggaagccattgct
gaaacgggctgtgatgcactaggtctggactggactatcgatatcagtgaagcccgccgc
cgtgtcggccacaaagttgctttgcagggcaatatggatccttccatgctctatgcaccc
ccggcgcgaattgagcaggaagtggcaacgattctggaaggattcggccagggtgaaggc
cacgttttcaatctgggacacggcatccatcaggatgttccacccgagcatgccggcgta
tttgttgaggcggtgcaccgtctgtcacgccagtatcattcggcgtcataa

DBGET integrated database retrieval system