KEGG   Pantoea ananatis LMG 20103: PANA_0228Help
Entry
PANA_0228         CDS       T01195                                 

Gene name
purH
Definition
(GenBank) PurH
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam00670  One carbon pool by folate
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_0228 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PANA_0228 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pam04147]
    PANA_0228 (purH)
Enzymes [BR:pam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     PANA_0228 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     PANA_0228 (purH)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA_0228 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-ProteinID: ADD75395
UniProt: D4GH80
Position
complement(270344..271933)
Genome map
AA seq 529 aa AA seqDB search
MQQPRPLRRALLSVSDKAGILEFAQALSQRGVELLSTGGTARLLAEAGLPVTEVSDYTGF
PEMMDGRVKTLHPKVHGGILGRRGQDDAVMAQHAISPIDMVVVNLYPFAQTVAKPDCSLE
DAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYPAIIAELDANQNSLTLETRFNLAIKAF
EHTAAYDSMIANYFGTLVPAYHGETSQPAGRFPRTLNLNFIKKQDMRYGENSHQDAAFYI
EENVQEASVATASQVQGKALSYNNIADTDAALECVKEFIEPACVIVKHANPCGVAVGESI
LAAYERAYQTDPTSAFGGIIAFNRELDEATAQAIISRQFVEVIIAPAATEAALKVTAAKQ
NVRVLVCGDWQGRVAALDFKRVNGGLLVQDRDLGMVDASQLRVVSKRQPSEQELRDALFC
WKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAGIKAGDEGLEVKGSAMASDAFFP
FRDGIDAAAAVGVSCVIQPGGSIRDDEVIAAADEHGIAMIFTDMRHFRH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacctcgtcctttacgccgcgccctgctcagtgtttctgataaagccggcatc
ctcgaatttgctcaggcactctctcagcgcggagttgagctgctctccacaggtggtacc
gctcgcctgctcgcagaggcgggacttcccgtcacagaagtgtctgactacaccggcttc
ccggaaatgatggatggacgcgttaaaacactgcacccgaaagtccatggcggcatttta
ggacgtcgtggacaagatgatgcggtgatggcgcagcatgctatcagcccgattgatatg
gtggtcgtcaatctttatccctttgcccaaaccgtcgcaaaaccagattgctcactggaa
gacgccgttgagaacattgatattggcggcccgacaatggtgcgctcggcggccaagaat
cacaaagacgtggcgattgtcgttaagagcagcgattatccggccattatcgctgagctg
gacgccaatcagaactcactgacgctcgaaacccgcttcaacctggcaatcaaagcgttt
gaacataccgccgcgtacgacagcatgatcgctaactacttcggtactctggttcctgcc
tatcatggtgaaaccagccaaccagccggccgcttcccgcgcaccctcaatctcaacttc
attaagaagcaggatatgcgctatggcgagaacagccatcaggacgccgccttctatata
gaagagaatgtgcaggaagcctcggtcgctaccgccagccaggtgcagggcaaggcactc
tcttataacaacattgcggataccgatgccgcgcttgagtgcgtgaaagagtttattgag
cccgcctgcgtcattgtcaaacatgccaatccttgcggtgttgcggtgggtgagtcaatt
ctggcagcttatgagcgtgcctatcagactgacccgacatctgccttcggcggcatcatt
gcctttaaccgcgagctggatgaggcgacagcccaggccatcatcagccgacagtttgtt
gaagtcatcatcgctcctgctgcaacggaagctgcgctgaaagtgaccgcggcaaaacaa
aacgtccgcgtgctggtatgcggtgactggcagggtcgcgtggctgcccttgatttcaaa
cgggtgaatggcggtctgctggttcaggatcgcgacctcggtatggtcgatgccagccag
ttgcgcgtcgtcagcaagcgccaaccttctgagcaggaactgcgtgatgccctgttctgc
tggaaagtggcgaaattcgttaagtccaacgccattgtctatgcgcgcgacaatatgacc
atcggcataggtgctggccagatgagccgcgtctactctgccaaaattgcaggaattaaa
gcgggtgatgaaggcctggaagtaaaggggtccgcgatggcttccgatgcgttcttcccg
ttccgggatggcattgatgccgctgctgccgtgggcgtaagctgtgtgattcagcctggc
ggttctatccgcgacgatgaagtgattgcggcagcggatgagcatggtattgccatgatc
tttaccgacatgcgtcacttccgccattaa

DBGET integrated database retrieval system