KEGG   Pantoea ananatis LMG 20103: PANA_0246Help
Entry
PANA_0246         CDS       T01195                                 

Gene name
pgi
Definition
(GenBank) Pgi
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00030  Pentose phosphate pathway
pam00500  Starch and sucrose metabolism
pam00520  Amino sugar and nucleotide sugar metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pam_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0246 (pgi)
   00030 Pentose phosphate pathway
    PANA_0246 (pgi)
   00500 Starch and sucrose metabolism
    PANA_0246 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_0246 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pam04147]
    PANA_0246 (pgi)
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     PANA_0246 (pgi)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PANA_0246 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   PANA_0246 (pgi)
  Exosomal proteins of colorectal cancer cells
   PANA_0246 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ADD75413
UniProt: D4GH98
Position
complement(301840..303519)
Genome map
AA seq 559 aa AA seqDB search
MTVLNINKSVAMKNINPTQTAAWKALQEHYEQMKTAKIADLFAQDADRFAKFSATFDDQM
LVDFSKNRITQETLDKLQALAKETDLSGAIKSMFSGEKINRTEDRAVLHVALRNRSNTPI
IVDGKDVMPEVNAVLEKMKGFSERIIGGDWKGYTGKPITDVVNIGIGGSDLGPFMVTEAL
RPYKNHLNMHFVSNVDGTHIAETLKDLSPETTLFLVASKTFTTQETMTNAHSARDWFLKT
AGDQQHVAKHFAALSTNAKAVGEFGIDTDNMFEFWDWVGGRYSLWSAIGLSIILSIGFDN
FEQLLSGAHAMDKHFSTTPAEQNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYF
QQGNMESNGKYVDRAGQPVTYQTGPIIWGEPGTNGQHAFYQLIHQGTKLVPCDFIAPAVS
HNALADHHPKLLSNFFAQTEALAFGKSRDVVQKEFTDAGKSAESVAHIVPFKVFEGNRPT
NSILLREITPFSLGALIALYEHKIFTQGAILNIFTFDQWGVELGKQLANRILPELENDSD
ITSHDSSTNALINRYKRWR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcttaatatcaacaagagtgttgccatgaaaaatatcaatccgacccaaacc
gcagcctggaaagcgctgcaagagcactatgaacagatgaaaacggcgaaaattgccgac
ctgtttgcccaggatgccgatcgttttgctaaattctcagccacctttgacgaccagatg
ctggtggatttttcgaaaaaccgcattactcaggaaaccctcgataagcttcaggcactg
gcaaaagagaccgatttaagcggtgcgattaagtctatgttctcgggtgagaagattaac
cgcactgaagatcgcgccgtgctgcacgtcgcgctgcgtaaccgcagtaatacgccgatt
atcgttgatggcaaagatgtcatgcctgaagtcaacgcagtgttggaaaaaatgaaaggc
ttttccgaacgcattatcggcggtgactggaaaggctataccggaaaacccattacggac
gttgttaacatcggtatcggtggctctgacctcggtcccttcatggtgacggaagcgctg
cgcccgtataaaaatcacctgaacatgcatttcgtgtctaacgtcgatggcacccacatt
gccgaaacgctaaaagatctgagtcctgaaaccacgctgttcctggtcgcctctaaaacc
ttcaccacccaggaaaccatgaccaacgcccacagtgcgcgtgactggttcctgaaaacg
gccggcgatcaacagcacgttgcgaagcactttgctgcgctctccaccaatgccaaagcg
gtaggcgaatttggtattgatacggacaacatgttcgaattctgggactgggtaggcggt
cgctattcactctggtcagcaattggtctgtcaattatcctttctattggcttcgataat
tttgagcagctgctgagcggcgcgcacgccatggataagcacttctcaaccacgccagcg
gagcagaatcttccggtgctgctggcgctgatcgggatctggtacaacaacttcttcggt
gccgaaacagaagccatcctgccgtacgaccaatatatgcatcgcttcgcggcctatttc
caacagggaaatatggaatcgaacggtaaatacgttgaccgtgcaggccagcctgttacc
tatcagacaggcccgattatctggggcgaaccaggtactaacggccagcacgcgttctac
cagctgattcatcagggcaccaaactggtcccgtgcgactttatcgcccctgctgtgagc
cacaatgcgcttgccgatcaccatcctaaactgctgtctaacttctttgcccagaccgag
gccctggcctttggtaaatcgcgtgatgtggttcagaaagagttcaccgacgccggaaag
tctgccgagtcggtcgcgcatattgtgccgtttaaagtgtttgaaggtaaccggcctact
aactctattttgttacgcgaaatcacgccgtttagcctgggtgccctgattgccctgtat
gaacataaaatcttcacccagggtgccattctgaacatctttaccttcgatcagtggggc
gttgagctgggcaaacaacttgcaaaccgtattctgccagagctcgaaaatgacagtgat
attaccagtcatgacagctccactaatgccttaattaatcgctacaagcgttggcgttaa

DBGET integrated database retrieval system