KEGG   Pantoea ananatis LMG 20103: PANA_0247Help
Entry
PANA_0247         CDS       T01195                                 

Gene name
lysC
Definition
(GenBank) LysC
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00261  Monobactam biosynthesis
pam00270  Cysteine and methionine metabolism
pam00300  Lysine biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01210  2-Oxocarboxylic acid metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
pam_M00017  Methionine biosynthesis, apartate => homoserine => methionine
pam_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_0247 (lysC)
   00270 Cysteine and methionine metabolism
    PANA_0247 (lysC)
   00300 Lysine biosynthesis
    PANA_0247 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    PANA_0247 (lysC)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     PANA_0247 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 T2SS-T3SS_pil_N
Motif
Other DBs
NCBI-ProteinID: ADD75414
UniProt: D4GH99
Position
304190..305542
Genome map
AA seq 450 aa AA seqDB search
MSLNLNVAKFGGTSVADFDAMNRSADVVLQDSNTRLVVLSASAGITNLLVSLAEGQETSQ
RAAQLDDIRRIQYAIIDRLQNPDVIRDEIDRIIDNIGMLSDAAALATSNALTDELVSHGE
LMSTLLFVEILRERKVNAEWFDVRKVMRTNDRFGRAEPDVVVLAEQVSAQLQPRIAASLV
VTQGFIGSEEKGRTTTLGRGGSDYTAALLGEALKASRVDIWTDVPGIYTTDPRVVPAAKR
IDEITFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPAAGGTRVCNETANPPLF
RALALRRKQTLVTLHSLNMLHTPGFLSEVFNILVRHNVSVDLITTSEVSVALTLDTTGST
STGDNLLSQALLTELSSLCRVEVEENLALVAIIGNELSKACGVGKEVFGVLEPFNLRMIC
YGASSYNLCFLVPGNDAESVVRTLHHNLFE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaatctgaatgtagcgaaatttggcggtaccagcgttgccgatttcgatgcc
atgaaccgtagcgccgatgtggtattgcaggacagcaatacccggctggtggtgctctct
gcctctgcaggcatcacaaacctgctggtctctcttgccgaaggccaggagacatcgcag
cgtgcagcgcaactcgatgacatccgccgcattcaatacgccatcatcgatcgtctgcaa
aatccggacgtcattcgcgacgaaatcgaccgcatcattgataacatcggcatgctgtcc
gatgcggccgcgctggccacgtctaacgccttaaccgacgaactggtcagccacggcgaa
ctgatgtcgaccttgctgttcgttgagatcctgcgtgaacgcaaggttaatgcagaatgg
ttcgatgtacgcaaagtcatgcgcaccaatgaccgttttggccgtgctgagcccgatgtg
gtcgtactggctgaacaggttagcgcgcagctgcaaccgcgtattgcggcgtcactggtg
gtgacccagggctttatcggcagcgaagaaaaagggcgcacgaccacgttaggtcgcggc
ggcagtgactacacggctgccttgctgggtgaagcgttaaaagcctcgcgcgtggatatc
tggacggacgtgccggggatctacaccaccgatccgcgcgtggtgcctgcggcaaaacgt
attgatgagatcacctttgaagaagcggctgaaatggccacctttggggccaaagtgctg
caccctgcgacgctgctgcctgcggtgcgtagcgacattccggtgtttgttggttccagt
aaagatcctgccgcgggcggtacgcgcgtgtgcaatgagacggcgaatccaccgctgttc
cgtgcgctggcgctgcgccgcaagcaaaccctggtcacgctgcacagcctgaatatgcta
cacacgccgggcttcctgtctgaagtgttcaacattctggtgcgtcacaacgtgtcagtg
gatctgatcaccacgtcggaagtcagcgtggcgttaacgctggataccacgggatcaacc
tcaacgggcgacaatctgctgagccaggcgctgctgacggagctgtcgtcactctgtcgg
gtggaagtggaagaaaacctggcgctggtggccattatcggcaacgaattgtcgaaagcc
tgcggcgtagggaaagaggtcttcggcgtgctcgaaccttttaacctgcggatgatctgc
tacggtgccagcagctacaatctctgtttccttgtgccgggcaatgatgctgaaagcgta
gtgcgtacactgcatcacaatttgtttgaataa

KEGG   Pantoea ananatis LMG 20103: PANA_0655Help
Entry
PANA_0655         CDS       T01195                                 

Gene name
thrA
Definition
(GenBank) ThrA
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00261  Monobactam biosynthesis
pam00270  Cysteine and methionine metabolism
pam00300  Lysine biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
pam_M00017  Methionine biosynthesis, apartate => homoserine => methionine
pam_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_0655 (thrA)
   00270 Cysteine and methionine metabolism
    PANA_0655 (thrA)
   00300 Lysine biosynthesis
    PANA_0655 (thrA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    PANA_0655 (thrA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     PANA_0655 (thrA)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     PANA_0655 (thrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3 ACT_7 ACT
Motif
Other DBs
NCBI-ProteinID: ADD75822
UniProt: D4GJL2
Position
759085..761547
Genome map
AA seq 820 aa AA seqDB search
MRVLKFGGTSVANAERFLRVADILESNAQQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDATRIFAELLQGLAEAQPGFDYDGLKSRVDSEFAQLKQVLHGISLLGQCPDSVNA
AMICRGEKLSIAIMEKLLEARGYGVSVIDPVEKLLAIGHYLESTVDIAESTRRIEASKIP
AENMILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTANPQAPGTLISANGE
QDEFPVKGITNLNNMAMFNVSGPGMKGMVGMAARVFATMSRTGISVVLITQSSSEYSISF
CVPQSEQARARRVLEDEFYLELKDGLLDALDVIENLAVISVVGDGMRTLRGISAKFFSAL
ARANINIIAIAQGSSERSISVVVNNDDVTTGVRVVHQMLFATDQVIEVFVVGVGGVGGAL
LDQLHRQQTWLKQKHIDLRVCGIANSRALLTNVHGIDLSDWKGEMAQAKEPFNLGRLIRL
VKEYHLLNPVIVDCTSSQAVADQYADFLAEGFHVVTPNKKANTSSWEYYQKMRVAAAGSR
RKFLYDTNVGAGLPVIENLQNLLNAGDELIRFSGILSGSLSYIFGKLDEGVSLSEATRMA
REMGFTEPDPRDDLSGTDVARKLLILAREAGHSLEMSDIEIEPLLPAHLNAIADVDQFMA
QLPEADAAIAARVEQARAEGKVLRLVGVIEEGGACKVKIDAVDGNDPLFKVKNGENALAF
YSRYYQPIPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgctgaaattcggtgggacctcggttgctaatgcagagcgttttctgcgcgtg
gccgatattctggaaagtaatgcgcaacagggacaggttgccaccgtgctttctgcgccc
gctaagattaccaaccatctggtcgcgatgatcgaaaaaaccattagcggtcaggatgcg
ctgccgaatatcagtgacgcgacgcgcatctttgcggagctgctgcaggggctggccgag
gcgcaacccggtttcgactatgacgggcttaaaagccgcgtagacagcgagtttgctcag
cttaaacaggtgctgcacgggatcagcctgttgggacagtgccctgacagcgtcaacgcc
gcgatgatctgtcgtggtgagaagctctcgattgcgattatggaaaagctgcttgaggca
cgaggttatggcgtcagcgttatcgatccggtcgagaagctgttagccatcggccactat
ctcgagtctaccgtggatatcgcagaatcaacccgccgcatcgaagccagtaaaattccg
gctgaaaatatgatcctgatggccggttttaccgccggtaatgagcggggcgagctggtg
gtgctgggccgaaacggttccgactactctgctgccgtgttggcggcttgtctgcgtgcc
gattgctgcgaaatctggaccgacgtagacggggtttatacctgcgatccccgtcaggtg
ccggatgcccgcctgctcaaatccatgtcataccaggaggcgatggagctctcctatttc
ggggcgaaagtcctgcatccacggactatcgcgcctatcgcccagttccagatcccttgc
ctgatcaaaaacacggccaatccgcaggccccaggtacgctgatcagcgccaatggtgaa
caggatgaattcccggttaagggcatcaccaacctgaataatatggcgatgtttaacgtg
tctggcccggggatgaaaggcatggtgggcatggccgcccgcgtgttcgcgaccatgtca
cgcaccgggatttcagtggtgttaatcacccagtcttcttctgaatacagcatcagcttc
tgtgttcctcagagcgagcaggcgcgagcgcgccgtgtgctggaagacgaattctatctt
gaactgaaagatggattgctggatgcgctggacgttatcgaaaatctggcggtgatctcg
gttgtaggggatggcatgcgcaccctgcgcgggatttcagcgaaattcttctctgccctg
gcgcgcgccaatatcaacattatcgctatcgctcagggatcgtctgaacgctctatttcg
gtcgtggtcaataatgatgacgtcaccacgggcgtgcgcgtcgtgcatcagatgctgttt
gccaccgaccaggtgattgaggtttttgtggtgggcgtcggcggagtcggcggcgccctg
ctggatcagctgcatcgccagcagacgtggcttaaacaaaagcacatcgatctccgcgtt
tgcggcattgcgaattcccgggcgctgttaaccaacgtgcacggtatcgatctcagcgac
tggaaaggcgaaatggcgcaggccaaagagccgtttaacctggggcgcttaattcgcctg
gttaaagagtatcatttactgaatccggtgattgtggactgtacctcgagccaggcggtt
gccgaccagtacgcagattttctggcggaaggttttcacgtggtcacgccgaataaaaag
gccaacacctcgtcgtgggaatactatcagaagatgcgtgtggcggcggcgggatcgcgt
cgtaagttcctgtatgacactaacgtcggcgcgggtttacccgtcattgagaacctgcaa
aatctgctcaatgcaggcgatgagttgatcaggttctcgggaattttatcaggatcgtta
tcctatatttttggcaagctggatgaaggtgtatcgctgtcagaagcgaccaggatggca
cgcgagatgggctttaccgagcccgatcctcgcgacgatctctctggtacggatgtcgcg
cgcaagctgctgattctggcgcgtgaagcggggcattcgctcgaaatgagcgacattgaa
atcgaacccctgctgcccgcgcatctgaatgccatcgccgatgtcgaccagtttatggcg
cagttacccgaagccgatgcggcgattgcagccagggtggaacaggcacgtgctgaaggc
aaagtgctgcgtctggttggcgtgatcgaagagggcggggcatgtaaagtgaagatcgat
gcggttgacggtaacgatccgcttttcaaagtcaaaaatggcgaaaacgcgctggccttt
tacagccgctattatcagccgattccgttagtattgcgcggatacggtgcaggaaacgat
gtgacagctgcgggcgtgtttgccgatctgctgcgcacactgtcatggaagttgggagtg
taa

KEGG   Pantoea ananatis LMG 20103: PANA_3848Help
Entry
PANA_3848         CDS       T01195                                 

Gene name
metL
Definition
(GenBank) MetL
  KO
K12525  bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00261  Monobactam biosynthesis
pam00270  Cysteine and methionine metabolism
pam00300  Lysine biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
pam_M00017  Methionine biosynthesis, apartate => homoserine => methionine
pam_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_3848 (metL)
   00270 Cysteine and methionine metabolism
    PANA_3848 (metL)
   00300 Lysine biosynthesis
    PANA_3848 (metL)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    PANA_3848 (metL)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     PANA_3848 (metL)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     PANA_3848 (metL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADD79015
UniProt: D4GDX3
Position
complement(4268918..4271359)
Genome map
AA seq 813 aa AA seqDB search
MMMTSSAGAGTPNNRQLHKFGGSSLADARCYQRVASIMADYSQPGDMMVVSAAGSTTNQL
ISWLKLSQSDRLSAHQVQQTLRRYQSELISALLPAEIAEPLITAFIRDLEKLAALLDGDV
TEAVYAEVVGHGEIWSARLMSAVLNQQDLHACWLDARDFLRAERAAQPQVDEGKSWPLLQ
TLLAQHPHKRIVVTGFICGNDAGETVLLGRNGSDYSATQIGALAGVGRVTIWSDVAGVYS
ADPRKVSDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTR
IERVLASGTGARIVTSHDDVCLVEIQLPEQHDFTLFQKEIDQLLTRAQMRPLAMGIHPDR
QLLQLCYTSEVVNSAFTLLQDAGLPGHLQLREGLALVALVGAGVTRNPLHTHRFWQQLKD
QPVEFISQSPEHISVVAVLRVGPTQHLIQGLHSSLFRAEKRIGLMLFGKGNIGSRWLELF
AREQETLSARTGFEFVLAGVVDSQRSLLSYEGLDASRALAFFDDEAEARDEESLFLWMRA
HPYDDLVVLDVTASKPLAQQYLDFASHGFHVISANKVAGASDTQTWREIRDAFEKTGRHW
LYNATVGAGLPINHTVRDLRESGDTILSISGIFSGTLSWLFLQFDGTVPFTDLVDQAWQQ
GLTEPDPRVDLSGQDVMRKLVILAREAGYNIEPDQVRVESLVPQSCEDESIDHFFENGDE
LNEQMLQRLEAAQEMGLVLRYVARFDANGKARVGVEAVRPEHPLAALLPCDNVFAIDSRW
YRDNPLVIRGPGAGRDVTAGAIQSDINRLARLL
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatgacgagttcagctggcgcaggaacgccaaacaacagacagctccacaagttt
ggtggcagcagccttgcagatgcacgctgctaccagcgtgtcgccagcattatggcggat
tacagccagccaggtgacatgatggtcgtatcggccgcgggctcgacgaccaatcagctg
attagctggctgaagctgagccagagcgaccgactgtccgcacatcaggtgcagcagaca
ttacgtcgctatcagagtgagctcatcagtgcactgttacctgccgaaatagccgaaccc
ttaattactgcctttattcgcgacctcgaaaaactggcggcgttactggatggtgacgtc
acagaagcggtctatgcggaagtggtgggccatggtgagatctggtctgcacgtttaatg
tcagcggtgctgaaccagcaggatcttcatgcctgctggctggatgcacgcgattttctg
cgcgcggaacgggccgcccagccgcaggtagatgaaggcaaatcctggccgttgttacaa
acgctgctggcccagcatccgcataaacgcatcgtggtaactggctttatctgcggcaat
gacgcgggcgaaacggtactgctggggcgtaacggttctgactactctgccacgcagatt
ggtgcgctggcaggtgtgggacgtgtgacgatctggagcgatgtggcgggcgtttacagt
gccgatccccgcaaagtctctgatgcctgtctgctgcccttgctgcgcctggatgaggcc
agtgagctggcgcgtctggcagccccggtactgcatacccgcaccttacagccggtctcg
ggcagcgatattgatttgcagttacgctgcagctatcagccggaacagggctctacccgt
atcgagcgcgtcctcgcgtccggtacgggcgcccgcatcgtcaccagccacgacgacgtg
tgcctggtagagatccaacttcctgagcagcacgattttacgctgtttcaaaaagagatc
gatcagctgctgacgcgcgcgcagatgcgtccgctggcgatgggcattcatcccgatcgt
cagctgctgcaactgtgctacacctctgaagtggtgaacagtgcctttactttattgcag
gacgccggcttacctggacatttgcagttacgtgaaggtttagcgctggtcgcgctggtt
ggcgctggcgtcacgcgcaacccgttgcacacgcaccgtttctggcagcagctaaaagat
cagccggtcgaatttatcagccagtcgccagagcacattagcgtggttgcggtgctgcgc
gttggccctactcagcatctcattcaggggttgcacagttccctgtttcgggcagaaaag
cgcattggcctgatgttgtttggcaagggcaacatcggttctcgctggctggagttgttt
gcccgcgagcaggaaacgttgtcggcgcgcaccggtttcgagtttgtgctagcgggcgtg
gtggacagccaacgcagcctgctgagctatgaaggtctggacgccagtcgcgcactggca
ttctttgacgatgaagcggaagcgcgcgatgaagagtcgctgtttctgtggatgcgcgcg
cacccttacgatgatctggttgtgctggatgtgacggccagtaagccgctggcacagcaa
tatcttgattttgccagccatgggtttcatgtcatcagcgccaataaagtggcgggagca
tcggatacgcaaacctggcgcgagattcgggatgcctttgaaaaaaccggccgccactgg
ttgtataacgccaccgtgggcgcaggtctgccgataaaccatacggtgcgcgatttacgg
gaaagcggtgacacgattttgtcgatcagcggtattttctccggaacgctgtcctggctg
tttctgcaatttgatggcacggtgccctttaccgacctggtggatcaggcgtggcagcag
ggattgacggaaccggatcctcgcgtcgatctgtcgggtcaggacgtgatgcgcaaactg
gtgattctggcacgtgaagcaggctataacatcgagccggatcaggtgcgcgtcgagtcg
ctggtgccgcagagctgcgaagatgaatcaatagatcactttttcgagaatggcgacgag
cttaatgagcagatgctgcaacggcttgaagccgcgcaggagatggggctggtgctgcgc
tatgttgcgcgcttcgatgctaacggcaaagcacgtgttggcgtcgaagcggtacgtccg
gagcatcctctggccgccttactgccttgtgacaacgtgtttgccatcgacagccgttgg
tatcgcgataatccgctggtgatccgcggacctggtgcaggccgggacgttaccgccggc
gctatccagtctgatattaatcgccttgcccgactcctctga

DBGET integrated database retrieval system