KEGG   Pantoea ananatis LMG 20103: PANA_0254Help
Entry
PANA_0254         CDS       T01195                                 

Gene name
plsB
Definition
(GenBank) PlsB
  KO
K00631  glycerol-3-phosphate O-acyltransferase [EC:2.3.1.15]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00561  Glycerolipid metabolism
pam00564  Glycerophospholipid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PANA_0254 (plsB)
   00564 Glycerophospholipid metabolism
    PANA_0254 (plsB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pam01004]
    PANA_0254 (plsB)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     PANA_0254 (plsB)
Lipid biosynthesis proteins [BR:pam01004]
 Phospholipid acyltransferase
  GPAT
   PANA_0254 (plsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase DUF3292 DUF4230
Motif
Other DBs
NCBI-ProteinID: ADD75421
UniProt: D4GHA6
Position
complement(312125..314578)
Genome map
AA seq 817 aa AA seqDB search
MLTRGFILSMSGWRILFYKLLNLPLSFLVKSKAIPADPVSEHGLDPTRPIMYVLPYDSKA
DLLTLRAQCIRHDLPDPLSPLEIDGALLPRHVFIHDGPRVFPYFVPSVESVKIFHEYLDL
HRSNPELDIQMLPVSVMFGRAPGREVQGEDNPPHLRLLNGVQKFFAVLWHGRDSFVRFSP
TVSLRRMATEHGTDKSIAQKLARVARIHFARQRLAAVGPRLPARQDLFNRLLQSKAIEKA
VEDEARSKKISHEKAQQNAIEMMEEIAANFSYEAIRVTDRVMGWLWSRLYQGINVNGGER
VRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPAGPIFRRLGA
FFIRRTFKGNKLYSTVFREYLGELFTRGYSVEYFVEGGRSRTGRLLDPKTGTLSMTLQAM
LRGGTRPITLVPIYIGYEHVMEVGTYAKELRGAVKEKEGFMQMVRGLRKLRNLGQGYVNF
GEPLPLINYLNKRVPEWRDSIDPIEAQRPGWLTPTANDIAATIMVRINEAGAANAMNLCV
TALLASRQRSLTREQLIEQLECYTQLLRNVPYSPDATLPDMSAEALLDHALSMNKFESEK
DSIGDIIILPREQAVLMTYYRNNIHHMLVMPALIAAIVQQHRNLSEAELLRQVSLIYPML
KSELFLRWSNDQLPQLLTDLCQELTRQGLITIEAGLLSFNTARYRTLQLLAAGVRETLQR
YAITFSILSAKPTINRGTLEKESRTLAQRLSVLHGINAPEFFDKAVFSSLVLTLRDEGYI
SDSGDADVAQTLATWHILAELVTSDVRMTIESAVAHD
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
ttgctaacaagaggcttcatattgtctatgtcaggttggcgtatacttttttataaatta
ctgaatttacccctttcgtttctggtaaagagtaaggccattccggccgatcccgtatcc
gaacatgggctggatcctacccggcctattatgtatgtcctgccttatgattcaaaggcc
gatctcctcactttgcgtgcgcagtgcatccggcacgatctgcccgatccgctctcacca
ctggagattgacggggccctgttgccgcgccatgtctttattcacgacggtccgcgcgtg
ttcccctatttcgtgcccagcgtcgagtcagtaaaaatcttccacgaatatcttgatctg
caccgcagtaatcctgagcttgatattcagatgttaccggtttcagttatgtttggtcgt
gcacctggtcgggaagtgcagggtgaagacaatccaccgcatttgcgcttgcttaacggc
gtacaaaaattctttgccgtgctctggcatggacgtgacagttttgtgcgcttctcaccg
accgtctctctgcgtcgtatggcgactgagcacggcacggataaatccatcgcccagaaa
ctggcccgggttgcccgtatccactttgcccgtcagcgtctggcggctgttggcccgcgc
cttcccgcgcgccaggatttgttcaaccgcctgctgcaatcgaaggcgattgaaaaagcg
gtagaagacgaagcacgcagtaaaaagatttcccatgagaaagcgcagcagaacgccatc
gagatgatggaagagattgccgccaacttctcctatgaagccattcgcgtgacggaccgg
gtaatgggctggctctggagccgcctctatcagggtatcaatgtgaacggcggtgagcgc
gtgcgtcagttggcgcaggacggacacgagatcgtttatgtgccctgccaccgcagccac
atggattacctgctgctgtcttacgtgctgtatcaccaggggctggtaccgccgcacatc
gccgccggtattaacctgaatttctggcctgccgggccgattttccgccgtctgggtgcc
ttctttattcgccgtacctttaagggcaacaagctctactccaccgttttccgcgaatat
ctgggcgagctttttacccgcggctattccgtcgagtacttcgttgaaggcggccgttca
cgtactggccgactgctggatcctaaaaccgggacgttatccatgacgctgcaggccatg
ctgcgcggcggtacgcgccctatcacgttagtgcctatttacatcggctatgaacatgtc
atggaagtgggaacctacgcgaaagaactgcgcggtgccgttaaagagaaagaaggcttt
atgcagatggtgcgcggcttgcgcaagctgcgtaacctcggccagggatacgtgaatttt
ggtgagccgctgccgctgataaattatctgaacaagcgcgttcctgaatggcgggattct
atcgatcccattgaagcccaacgcccgggttggttaaccccaacggcgaatgatatcgcg
gccaccatcatggtgcgaatcaatgaagccggcgcggcgaatgccatgaacctgtgcgtg
accgccctgcttgcttcacgtcagcgctcactaactcgcgagcagctgattgagcaactg
gagtgctacacccagttactgcgcaatgtgccctactcaccggatgcaacattgccagac
atgtccgccgaagccttgctggaccatgcccttagcatgaacaagttcgagagtgagaaa
gacagtattggtgacatcattattctgccgcgcgagcaggccgtgctgatgacctactac
cgtaataacattcatcatatgctggtgatgccagcgctgattgcggcgattgtgcagcag
caccgtaatctgagcgaagccgaactgctgcgtcaggtcagtctgatttaccccatgctg
aagagcgaactgttcctgcgctggagcaatgaccaactgccgcagttgctcactgatttg
tgccaggaactgacgcgtcaggggctgattaccattgaagcgggcctgctgtcgttcaat
accgcgcgttaccgtacgcttcagctgctggccgcaggtgtacgtgagacgctgcagcgc
tacgccattactttctccatcctgagtgccaagcccaccatcaaccgtggcacgctggaa
aaagagagccgtaccctggcgcagcgtctgagcgtgttgcacggcatcaacgcgccggag
ttctttgataaagcggtgttctcctcactggtgctcacactgcgtgatgaaggctatatc
agcgacagtggcgatgcagacgtggcgcagacgctggcgacctggcatatcctggctgag
ctggttaccagcgatgtacgcatgaccattgagagcgctgtcgcgcacgattaa

KEGG   Pantoea ananatis LMG 20103: PANA_1480Help
Entry
PANA_1480         CDS       T01195                                 

Gene name
plsX
Definition
(GenBank) PlsX
  KO
K03621  phosphate acyltransferase [EC:2.3.1.274]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00561  Glycerolipid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PANA_1480 (plsX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pam01004]
    PANA_1480 (plsX)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.274  phosphate acyltransferase
     PANA_1480 (plsX)
Lipid biosynthesis proteins [BR:pam01004]
 Phospholipid acyltransferase
  GPAT
   PANA_1480 (plsX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_synthesis
Motif
Other DBs
NCBI-ProteinID: ADD76647
UniProt: D4GC44
Position
1667794..1668834
Genome map
AA seq 346 aa AA seqDB search
MARLTLAIDAMGGDFGPCVTVPAALQALASHSEIILLLVGDPDILTPLLAKADSSLLERL
QVVPAESVIASDARPAQAIRNSRGSSMRVALELVKEGRAQACVSSGNTGALMGLATLLLK
PLDGIKRPALMTVLPHQQKGKTVILDLGANVDSDSAMLVQFAVMGSVMAEEVLGIANPRV
ALLNIGHEEHKGLESIRDAALSLKALPQINYIGYLEGNDLLTGKTDVLVCDGFAGNITLK
TMEGVVRMFLSLFKSSEEGKKRSWWLTLLGRWMKKRLVRRFGHLNPDQYNGACLLGLRGT
VIKSHGAANQHAFAVAINQAEQTVRRQVPERIAARLDAVLARSDKA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttggcacgtttgaccctggctatcgatgccatgggcggggacttcggtccctgcgtgacg
gtgcctgcagcattgcaggcactggcctctcattcggaaattatccttcttcttgtcgga
gatcccgacattctcacgccattgcttgccaaagcggattcctccttgctggagcgactg
caggttgtgcctgccgaatcagttattgcaagtgatgcgcgacccgcacaagccatccgt
aacagccgcggcagttctatgcgagtggcgttagagttggttaaagaagggcgggctcag
gcctgcgtcagcagcggcaacacgggcgcgctgatggggctggcgacattattactgaag
ccgctggacgggattaaacgtccggcgcttatgaccgttttaccccatcagcagaaggga
aaaacggtcattttagatttaggtgccaatgtcgactcagacagtgcgatgctggtgcag
tttgcggtaatgggctcagtgatggcggaagaagtgttggggattgcgaatccccgtgtg
gcacttctcaatattggtcatgaagagcataaagggcttgaaagcatccgcgatgcggcg
ttaagtctcaaggcattgccgcagattaactacattggttaccttgaaggtaatgattta
ctgactggcaaaacggatgtgctggtctgtgatggtttcgcaggaaacatcactctgaag
acaatggaaggcgtagtaagaatgtttctttctctgttcaagtcatcagaggaaggtaag
aagcggtcgtggtggctgacgttgctggggcgctggatgaaaaagcgtttggtcaggcgc
ttcgggcatctcaaccccgaccagtataatggcgcttgtctgttaggattacgcgggaca
gtgataaagagccatggtgcagcaaatcaacatgcttttgccgtggcgatcaatcaggcc
gagcagacggtgaggcggcaggtgcctgaacgcattgccgcccgtctggacgctgtatta
gccaggagtgacaaagcctag

KEGG   Pantoea ananatis LMG 20103: PANA_3386Help
Entry
PANA_3386         CDS       T01195                                 

Gene name
ygiH
Definition
(GenBank) YgiH
  KO
K08591  acyl phosphate:glycerol-3-phosphate acyltransferase [EC:2.3.1.275]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00561  Glycerolipid metabolism
pam00564  Glycerophospholipid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PANA_3386 (ygiH)
   00564 Glycerophospholipid metabolism
    PANA_3386 (ygiH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pam01004]
    PANA_3386 (ygiH)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.275  acyl phosphate:glycerol-3-phosphate acyltransferase
     PANA_3386 (ygiH)
Lipid biosynthesis proteins [BR:pam01004]
 Phospholipid acyltransferase
  GPAT
   PANA_3386 (ygiH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G3P_acyltransf
Motif
Other DBs
NCBI-ProteinID: ADD78553
UniProt: D4GN61
Position
3778825..3779424
Genome map
AA seq 199 aa AA seqDB search
MSAFALGMIIFAYLCGSISSAILVCKLAGLPDPRTHGSGNPGATNVLRIGGKLAAASVLV
FDIVKGMLPVWLAYLFHVPPLYLGLTAIAACLGHIYPVFFRFRGGKGVATAFGAIAPIGW
DLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN
IQRLWRGQESKIWKRKKKK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttcgcgcttggtatgattattttcgcgtatctgtgcggttcaatttccagt
gcgattctggtttgcaaactcgccggtttacccgatccccgcacccacggttcaggcaac
ccgggcgcaaccaacgtactgcgtatcggcggcaaactggcggctgcgtctgtgctggtg
ttcgatattgtgaaaggtatgctgcccgtgtggctggcctatctgtttcatgtgcccccg
ctttatctgggcttaaccgccattgctgcctgtctgggccatatttatccggtgtttttt
cgctttcgtggcgggaaaggcgtggcgacggcgtttggtgcaatcgcccccattggctgg
gacctgaccggactcatgacgggaacgtggctactgaccgtgctgctgagcggctactca
tcgcttggcgcgattgtcagcgcgcttatcgcgccgttttatgtctggtggtttaagcca
cagtttacgtttccggtttccatgctctcctgcctgattttactgcgtcatcatgacaac
attcagcgcctgtggcgcggtcaggaaagcaaaatctggaagcgaaaaaagaaaaagtaa

DBGET integrated database retrieval system