KEGG   Pantoea ananatis LMG 20103: PANA_0292Help
Entry
PANA_0292         CDS       T01195                                 

Gene name
acs
Definition
(GenBank) Acs
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00620  Pyruvate metabolism
pam00630  Glyoxylate and dicarboxylate metabolism
pam00640  Propanoate metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0292 (acs)
   00620 Pyruvate metabolism
    PANA_0292 (acs)
   00630 Glyoxylate and dicarboxylate metabolism
    PANA_0292 (acs)
   00640 Propanoate metabolism
    PANA_0292 (acs)
  09102 Energy metabolism
   00680 Methane metabolism
    PANA_0292 (acs)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pam01004]
    PANA_0292 (acs)
Enzymes [BR:pam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PANA_0292 (acs)
Lipid biosynthesis proteins [BR:pam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PANA_0292 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADD75459
UniProt: D4GHE4
Position
complement(351362..353344)
Genome map
AA seq 660 aa AA seqDB search
MINIFKEIRHEPTSYLSCSRKYCSKRADYCRTVSGDVPAIGYRSRNILGEQGKILDWIKP
YSKVKNTSFAPGNISIRWYEDGTLNLAANCLDRHLATRGDHPAIIWEGDDASESKTITFR
QLHADVCRFANVLELLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAV
AGRVIDSSAALIVTADEGVRAGRTIPLKKNVDEALKNPNVNSVKNVVVFQRTGKDVGWVE
GRDRHWHELMQNASTNHSAAEMQAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKF
VFDYHQDDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTSARMAQVVDKHKV
TLLYTAPTAIRALMAEGDKAIEGTDRSSLRIMGSVGEPINPEAWEWYHKKIGNSQCPIVD
TWWQTETGGFMITPLPGATRLKAGSATTPFFGVQPALVDNEGHPQEGACEGNLVITDSWP
GQARTLFGDHDRFEQTYFSTFKNAYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAE
IESALVSHPKIAEAAVVGIPHSIKGQAIYAYITLNHGEEPSPELYTDVRNWVRKEIGPIA
TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSITMP
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgattaacatcttcaaggagattcgccatgagccaacatcatatctatcctgttccaga
aaatattgcagcaaacgcgctgattactgccgaacagtatcaggcgatgtaccagcaatc
ggttaccgatccagaaacattctgggggagcaaggtaaaatccttgactggataaagcct
tacagcaaagttaaaaacacgtcttttgcgcctggtaatatttccattcgttggtatgag
gacggcacgctcaatctggcggcgaactgcctggatcgtcacctggcaacccggggcgat
catcctgccatcatctgggaaggtgatgatgccagcgaaagcaaaacaataacctttcgt
cagcttcacgccgatgtctgtcgctttgccaacgtgttggagctgctcggggttaaaaaa
ggcgatgtcgtcgcgatttatatgccaatggtgccggaagccgcggtcgccatgctggcc
tgcgcgcgcattggcgccgtgcattcggttatttttggcggcttttcaccggaagcggtg
gcaggtcgcgtgatcgactccagtgcagccttaattgtgacagccgatgaaggcgtgcgc
gcggggcgtacgatcccactgaaaaaaaatgtggatgaagcgttaaaaaatcccaacgta
aacagcgtgaaaaacgtcgtggtctttcaacgtaccggcaaagacgtcggttgggttgaa
ggacgtgacaggcactggcacgagctgatgcagaacgccagtaccaaccactctgcggca
gaaatgcaggcagaagatccgctgtttatcctgtatacctcaggttcaaccggcaagccg
aaaggcgtgctgcatacgaccggcggctatctggtttacgccgcgaccacctttaagttt
gtttttgactaccatcaggacgatatctactggtgtacggctgacgtaggctgggttacc
ggacacagctatctgctgtatggcccgctggcctgcggtgccacgacgctgatgtttgaa
ggcgtgcctaactggccgacgtccgcccgcatggcgcaggtggtggataagcataaagtc
accctgctctacaccgcgcccacggctatccgcgcgctgatggccgaaggggacaaggcg
attgaaggcaccgaccgtagcagcctgcgtattatgggttcggtcggtgagccgattaat
ccggaagcctgggagtggtatcacaaaaaaatcggcaacagccagtgtccaatagtggat
acctggtggcagaccgaaaccggggggtttatgatcaccccgctacccggcgcaacgcgg
cttaaggccggttctgcgaccacgcctttctttggcgtacagcccgcgctggtcgataat
gaggggcatcctcaggaaggagcctgcgaaggtaacctggttatcactgactcctggcca
ggccaggcccgaacgctgttcggcgatcacgaccgtttcgaacaaacctatttctctacc
ttcaaaaatgcctactttagcggtgacggcgcgcgacgggatgaggacggttattactgg
atcaccggccgcgtggatgatgtgctgaatgtgtcagggcatcgtctgggcacggcagaa
atcgaatcggccctggtttcccaccctaaaattgccgaagccgctgtggtggggatcccg
cacagcattaagggccaggccatttacgcctatatcaccctgaatcacggcgaggagccc
tcaccagagctttataccgacgtgcgtaactgggtacgcaaagaaattggcccgatcgcc
acgcccgatgtgctgcactggaccgactctctgccaaaaacccgctccggtaaaatcatg
cgccgtatcctgcggaaaatcgccgcgggtgataccagtaatttaggcgatacgtcaacg
ctggccgatcctggcgtcgttgagaaactgcttgaagagaaacagtccatcaccatgccg
taa

DBGET integrated database retrieval system