KEGG   Pantoea ananatis LMG 20103: PANA_0489Help
Entry
PANA_0489         CDS       T01195                                 

Gene name
argI
Definition
(GenBank) ArgI
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00220  Arginine biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01230  Biosynthesis of amino acids
Module
pam_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PANA_0489 (argI)
Enzymes [BR:pam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PANA_0489 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ADD75656
UniProt: D4GIR1
Position
complement(571657..572664)
Genome map
AA seq 335 aa AA seqDB search
MSQLYQRHFLRLLDFTPAEIDYLLTLSAELKRAKKTASETQYLKGKNIALIFEKDSTRTR
CSFEVAAYDQGANVTYLGPSGSQIGHKESMKDTARVLGRMYDGIQYRGYGQALVETLAEH
AGVPVWNGLTTEFHPTQLLADLLTMQEHLPGKPLSEMTLVYVGDARNNMGNSMLEAAAQV
GLDLRMVAPQSCWPEADLVAQCRQVAEQTGGKITLTADIAEGVKGADFIYTDVWVSMGEA
KAVWEERIALLRDYQVNHAMLALTGNPQVKFLHCLPAFHDDQTTLGRQMAEQYGLQDGME
VSNDVFESAHSIVFDQAENRMHTIKAVMVATLGQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagttgtatcaacgtcatttcctcaggctgctggattttaccccggctgagatt
gactacttgcttaccctgtccgccgaattaaaacgcgcaaaaaaaaccgccagtgaaacc
cagtacctgaaaggcaaaaacatcgcgctcatcttcgaaaaagactcgacccgtacccga
tgctctttcgaagttgccgcttacgatcagggggcaaacgtcacttacctcggcccaagc
ggcagccagatcggccataaagagtcgatgaaagacaccgcgcgcgtgttaggccgcatg
tatgacggtattcagtatcggggttacggtcaggcactggtcgaaaccctggcggaacat
gctggcgtgccggtgtggaacggcctgaccaccgagttccatccaacgcagctgctggcc
gatctgctgaccatgcaggagcatctgccaggcaagccgctcagtgagatgaccctggtg
tacgtgggcgatgctcgcaacaatatgggtaacagcatgctggaagcggcggcacaggtt
ggcttagatctgcgtatggtcgcgccgcaaagctgctggccggaagccgacctggtggct
cagtgccgtcaggttgccgaacagaccggcggcaaaatcaccctgacggcagatattgct
gagggcgtgaaaggcgccgatttcatctataccgacgtctgggtttccatgggtgaagcc
aaagcagtgtgggaagaacgtattgccctgctgcgcgactatcaggtcaatcacgcgatg
ctcgcgctgaccggcaatccgcaggtgaaattcctgcactgcttaccggccttccatgac
gatcagaccacgctgggccgtcagatggcggaacagtacggcctgcaggatggcatggag
gtcagtaatgacgtctttgagtcggcgcacagcatcgtattcgatcaggcggaaaaccgg
atgcacaccattaaagcggtgatggtcgccacgctgggacagcgctaa

DBGET integrated database retrieval system