KEGG   Pantoea ananatis LMG 20103: PANA_0682Help
Entry
PANA_0682         CDS       T01195                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
pam  Pantoea ananatis LMG 20103
Brite
KEGG Orthology (KO) [BR:pam00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PANA_0682 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ADD75849
UniProt: D4GJN9
Position
complement(792918..793295)
Genome map
AA seq 125 aa AA seqDB search
MSEPARVSLHVQSLYVASQSSPEDERYVFAYTVTIRNVGRSSVQLLRRYWLITNGNGRET
EVQGEGVIGEQPHIAPGNEYQYTSGAVLETPMGTMQGHYVMVDEQGDEFHVEIPVFRLAI
QTHIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaccggcccgcgtatcgctgcacgtacaaagtctgtatgtcgcctcacagtcc
tcaccggaagatgagcgctatgtctttgcttataccgtcacgattcgcaacgtaggccgc
tcctcagtgcaactgctccgacgctactggctcatcactaacggcaacggccgtgagacg
gaagttcagggtgaaggcgtcataggcgaacagccgcatattgcaccgggaaacgaatat
caatacaccagcggtgctgttcttgaaaccccgatgggcaccatgcaaggtcactatgtg
atggtcgatgagcaaggcgatgaattccacgtcgagatcccggtattccgcctcgcgatt
caaacccacatccattga

DBGET integrated database retrieval system