KEGG   Pantoea ananatis LMG 20103: PANA_0699Help
Entry
PANA_0699         CDS       T01195                                 

Gene name
aroD
Definition
(GenBank) AroD
  KO
K03785  3-dehydroquinate dehydratase I [EC:4.2.1.10]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_0699 (aroD)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     PANA_0699 (aroD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_I AlkA_N Imm75
Motif
Other DBs
NCBI-ProteinID: ADD75866
UniProt: D4GJQ6
Position
complement(815928..816689)
Genome map
AA seq 253 aa AA seqDB search
MTMTQTVRVKNIVFQEGQTRLCVPLTGRTREELQARAQLLTSAQADIIEWRVDHFIEGKD
EKQVLLALADIRQQLGETPLLFTFRSKKEGGEMDISDDQYFALNHAAALSGLADVIDIEL
FNDESRIRSLVSEAHNAGVKVIMSNHDFHQTPAKEEIIYRLRRMQDLGADLPKIAVMPQT
PQDVLTLLSATLLMKEHYATRPLITMSMGKMGGVSRVTGRLFGSAMTFGALGQSSAPGQI
AVTQLREMMETLS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgactatgactcaaacggttagggttaaaaacatcgtctttcaggaagggcaaacgcgg
ctttgtgtgcccttgacaggccgcactcgcgaggagcttcaggccagagcacagttactg
acttccgcacaggcagacattatcgaatggcgcgtcgaccacttcatcgagggtaaagac
gagaagcaagtcttgctggcgctggccgacattcgtcagcaacttggggaaacgccgctg
ctctttaccttccgcagtaaaaaagaaggtggcgaaatggacatcagtgatgaccaatac
ttcgcgctcaaccacgcggccgccttaagcgggctggctgatgtgattgatattgagttg
tttaacgatgagtcacgcatccgttcgctggtaagcgaggcgcataacgcaggtgttaag
gtcattatgagtaatcatgactttcaccaaacgcccgcgaaggaagagatcatttaccgg
ttacgtcgcatgcaggatttaggtgcagacctgcccaagattgccgtaatgcctcaaaca
cctcaggatgtgctgacgctgctgtctgcgaccctgttaatgaaagagcactacgcaacg
cggccgcttatcacgatgtcgatgggaaaaatgggcggagtcagtcgggtcaccggacgc
ctgttcggttccgcaatgacgtttggcgccctgggccagtcctcggcaccagggcaaatc
gccgttacacaactgcgggagatgatggagacgctttcctag

KEGG   Pantoea ananatis LMG 20103: PANA_3570Help
Entry
PANA_3570         CDS       T01195                                 

Gene name
aroQ
Definition
(GenBank) AroQ
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_3570 (aroQ)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     PANA_3570 (aroQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-ProteinID: ADD78737
UniProt: D4GCC6
Position
3974539..3975057
Genome map
AA seq 172 aa AA seqDB search
MTNGKRQGILRDASMIAGDGSKMADKLHILLLNGPNLNLLGTREPEKYGDVTLDQIVSDL
SHQADQLNVRLSHMQSNAEFQLIDRIHEAKGNVDYILINPAAFTHTSVALRDALLAVNIP
FIEVHLSNVHGREPFRHHSYFSDVSAGVICGLGADGYSWALQTAVKRLSHTN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaatggaaagcggcaaggtattttacgcgatgcctcaatgattgcgggagatggc
agcaagatggccgacaaattacatattctgcttttgaacggtcccaaccttaatctgtta
gggacgcgcgagcctgaaaaatacggggatgtcaccctggatcagatcgtttccgatttg
agccatcaggcagaccagctgaatgtaagattaagccatatgcaatccaatgctgaattt
cagcttattgatcgcattcatgaggcaaaaggcaatgtggattatatccttatcaatcct
gctgcgtttacgcataccagcgtagcattacgtgatgcgctgctagcggtgaatattccc
tttatcgaagttcacctgtcaaatgtgcacggtcgcgagccttttcgccatcactcctat
ttttctgatgtctctgctggcgtcatttgtgggcttggcgctgacggttactcgtgggca
ttgcaaacggcagtaaagcgcctgtctcatactaattaa

DBGET integrated database retrieval system