KEGG   Pantoea ananatis LMG 20103: PANA_0704Help
Entry
PANA_0704         CDS       T01195                                 

Gene name
leuC
Definition
(GenBank) LeuC
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00290  Valine, leucine and isoleucine biosynthesis
pam00660  C5-Branched dibasic acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01210  2-Oxocarboxylic acid metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    PANA_0704 (leuC)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PANA_0704 (leuC)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     PANA_0704 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     PANA_0704 (leuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Nodulin
Motif
Other DBs
NCBI-ProteinID: ADD75871
UniProt: D4GJR1
Position
complement(821849..823180)
Genome map
AA seq 443 aa AA seqDB search
MLYIDRHLIHEVTSPQAFDGLRAHGRKVRQPSKTFATMDHNVSTQTKDINASGEMARIQM
QELMKNCAEFGVQLYDLNHPFQGIVHVIGPEQGMTLPGMTIVCGDSHTATHGAFGSLAFG
IGTSEVEHVFATQTLKQGRAKTMKIEVTGTVAPGITAKDIVLAIIGKTGSAGGTGHVVEF
CGSAIEALSMEGRMTLCNMAIEMGAKAGLVAPDETTFAYLKGRQFSPQGEKWEQAVEYWG
TLKSDPGAKFDRVVTLHAEEIAPQVTWGTNPGQVIAVDAQIPDPASFADPVERASAEKAL
AYMNLQPGIKLTDVSIDKVFIGSCTNSRIEDLRAAAAIAKGRKVAPGVQALVVPGSGPVK
AQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTH
LVSPAMAAAAAVNGHFADIRSLT
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgctctatatcgatcgtcatctgattcatgaggtgacttcgccacaggcctttgatggc
ttgcgtgcccacggtcgtaaagttcgtcagccttcaaagacgtttgccaccatggatcac
aacgtgtccacccagaccaaagatattaatgcttcgggtgaaatggcgcgtattcagatg
caggaactgatgaaaaactgtgccgaattcggcgtgcagttgtatgacctgaatcacccg
ttccagggcatcgtgcatgtgattgggccagagcaaggcatgacgctgcccggcatgacc
attgtctgcggcgattcccacacggcgacgcacggtgcctttggttcactggcctttggt
attggtacgtcagaggttgagcatgtttttgccacgcaaaccctgaaacagggccgtgcc
aaaaccatgaagattgaagtgacaggtacggttgcgccgggcattacggcgaaagatatc
gtactggcgattattggtaaaaccggcagcgcaggcggtaccggccacgttgttgaattc
tgtggctcggcgattgaagcgctgagcatggaaggccgcatgacgctgtgcaacatggct
atcgagatgggcgcaaaagccggtctggtcgccccggatgagaccaccttcgcttacctg
aaaggtcgccagttttcacctcaaggtgaaaaatgggagcaggccgttgagtactggggc
acgctgaagtccgacccaggcgctaagtttgaccgcgtggtgacgctgcatgcggaagag
attgcaccgcaggtgacctggggaactaaccctggccaggtgatcgcggtggacgcgcag
attcccgatccggcttcgtttgccgatccggtcgagcgcgcctctgcggagaaagcgctg
gcttacatgaatctgcaacccggcatcaaactgaccgatgtcagcattgataaagtcttt
attggctcctgcacaaactcacgcattgaagatctgcgtgccgccgccgcgattgccaaa
gggcgtaaggtcgcgcctggcgttcaggcactggtggtgccgggttcaggcccggttaaa
gcacaggccgaagcggaagggctggataagatctttattgaagcaggatttgagtggcgc
ctgcccggctgctcaatgtgtctggccatgaacaacgaccgtctgaaccccggcgagcgc
tgtgcctcaaccagtaaccgtaactttgaaggccgccagggccgtggcggacggacgcat
ttggttagcccggcaatggccgccgctgccgccgttaatggccatttcgccgacattcgc
agcctgacataa

KEGG   Pantoea ananatis LMG 20103: PANA_3288Help
Entry
PANA_3288         CDS       T01195                                 

Gene name
leuC
Definition
(GenBank) LeuC
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00290  Valine, leucine and isoleucine biosynthesis
pam00660  C5-Branched dibasic acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01210  2-Oxocarboxylic acid metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    PANA_3288 (leuC)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PANA_3288 (leuC)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     PANA_3288 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     PANA_3288 (leuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521 Rad60-SLD
Motif
Other DBs
NCBI-ProteinID: ADD78455
UniProt: D4GMW3
Position
complement(3664806..3666044)
Genome map
AA seq 412 aa AA seqDB search
MKSNQPIVNQIIASHSGRGQVSAGELITVDVDYVYVQDGNSPTVAKLFQDYHLSEVLKPD
KIGFFFDHSVLVPDKTMAKRVNEAMEFAKKLGINIYSRGEGISHVIALESKIFKPGNIVL
GADSHTCTGGPYSLLALGMGASDILVAMLTGQTWLKVPQTVHLCIKGKTGKDVRAKDVML
ALLNKYGQTPFLYKSIEVSGEWAEELTLDEAASFASMAVELGAKCIFMPDGQGRPEGLLK
ADASVADSVINFSVSELMPHIAPPHSPLYAKPANDFEGLKFDYIFIGSCTNSRLEDIKEV
AEIVAGKTIHPDIHCLLTPGSKSVYLKALQAGYIDTLIRSGIIVTPPGCGACVGTQGTIP
ADGEKVLSTMNRNFKGRMGNAEADIFLCSPRTAAMVALNGTVPHFEGESAYE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaatcagccgattgttaaccagatcattgcgtcacacagtggcagaggtcag
gtttcagcaggtgaactgatcacggtagatgttgactacgtctatgttcaggatggaaat
tcaccgaccgtggcaaaactgtttcaggattatcatctgtctgaggtgctaaaacccgat
aaaatcgggttcttcttcgaccattcagttctggtacctgataaaaccatggctaaacgt
gtcaacgaggccatggaatttgcaaaaaaacttggaataaacatctattcacgaggggag
ggaattagtcacgtcattgccctggagagtaaaatatttaaacccggcaatatagtgctg
ggcgcagattcccatacttgtacaggggggccgtacagtcttttagcgctgggaatgggg
gcttcggatattctggttgctatgttaacaggacaaacgtggttgaaagtccctcaaaca
gtccatttgtgtattaagggtaaaacgggaaaagatgtgcgggcaaaagatgtcatgttg
gcacttttaaataagtacggacaaacaccatttctttataaatcgatcgaagtttcaggg
gaatgggcagaagagctaacgcttgacgaagctgcaagttttgcaagtatggctgttgag
ttaggagccaaatgcatatttatgccagatgggcaaggcaggcctgaggggctattgaag
gcggatgcctcagtggcagacagtgtcatcaatttttctgtatcagaattaatgccccat
atcgcaccacctcacagtcctttgtatgctaaacctgcaaatgactttgagggtctgaaa
tttgattatattttcattggaagctgtactaacagcagacttgaagatatcaaagaggtg
gccgaaattgttgctggtaaaacaatacatcccgatattcactgccttctgacgccagga
tcgaaaagtgtttatctaaaagctctccaggcgggatatatcgatacgcttatccgctcg
ggcattattgtcaccccaccgggttgtggagcttgtgtgggtacccaaggaaccattcct
gcggatggggagaaagtattaagtacgatgaaccgcaattttaagggaagaatggggaat
gctgaggcagacatctttttatgttctccacgaactgcagcgatggttgcattgaacggc
actgttccacattttgagggagagtccgcatatgagtaa

DBGET integrated database retrieval system