KEGG   Pantoea ananatis LMG 20103: PANA_0743Help
Entry
PANA_0743         CDS       T01195                                 

Gene name
aceE
Definition
(GenBank) AceE
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00020  Citrate cycle (TCA cycle)
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0743 (aceE)
   00020 Citrate cycle (TCA cycle)
    PANA_0743 (aceE)
   00620 Pyruvate metabolism
    PANA_0743 (aceE)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     PANA_0743 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADD75910
UniProt: D4GK81
Position
866508..869174
Genome map
AA seq 888 aa AA seqDB search
MSERLHNDVDPIETRDWLQAIESVIREEGVERAQYLIDQVLSAARKGGVKVAGGAAAISN
YINSIAVEDEPDYPGNTSLERRIRSAIRWNAIMSVLRASKKDLELGGHMSSFQSSATIYE
VCFNHFFRARSEKDGGDLVYFQGHISPGIYARAFLEGRLTEEQMNNFRQEVDGKGLSSYP
HPKLMPEFWQFPTVSMGLGPLNAIYQAKFLKYLEHRGLKDTSGQTVYAFLGDGEMDEPES
KGAITIATREKLDNLVFIINCNLQRLDGPVTGNGKIINELEGIFAGAGWEVIKVIWGGRW
DELLRNDTSGKLIQLMNETVDGDYQTFKSRDGAYVREHFFGKYPETAALVKDWSDDEIWA
LNRGGHDPKKIYAALKKAQDTKGKPVLILAHTIKGYGMGDTAEGKNIAHQVKKMNMDGVR
YIRDRFNVPVEDDKIESLPYITFDKGSEEYNYLHGQREKLGGYLPSRQPRFTEKLEMPAL
EEFSALLEEQNKEISTTIAFVRALNVMLKNKSIKDRLVPILADEARTFGMEGLFRQIGIY
SPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGSSWLAAATSYSTNNLPMIPFYIY
YSMFGFQRIGDLMWLAGDQQARGFLVGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISY
DPSYAYEVAVIMHDGLVRMYGEAQENIYYYITTLNENYHMPAMPKGAEEGIRKGIYKLET
VEGSKGKVQLLGSGSILRHVREAAQILATDYGIGSDVYSVTSFTELARDGQDCERWNMLH
PTEAPRVPYIAQVMNEAPAVASTDYMKLFAEQVRSYVPSSDYRVLGTDGFGRSDSRENLR
HHFEVDASYVVVAALGELAKRGEIDKKVVADAIVKFKIDADKVNPRLA
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgtttacacaatgacgtggatccgattgaaactcgtgactggctacaggcg
atcgaatcggtcatccgtgaagaaggtgttgaacgtgcacagtatctgattgatcaggtg
ctgagtgcagcccgcaaaggcggtgtgaaagttgctggcggtgctgccgcaatcagtaac
tacatcaactctattgccgttgaagatgaaccggattatccgggcaacacctcacttgaa
cgtcgtatccgttccgccattcgctggaacgccatcatgtcggtgctgcgcgcatcgaag
aaagatctggaacttggcggccacatgtcctccttccagtcttctgccaccatctatgaa
gtgtgttttaaccacttcttccgcgcgcgcagtgaaaaagacggcggcgatctggtgtac
ttccagggccacatttctccgggtatctatgcccgtgctttcctggaaggtcgtctgact
gaagagcagatgaataacttccgtcaggaagtggatggcaaaggcctgtcctcttatccg
catccaaaactgatgccggaattctggcagttcccgaccgtctccatgggtctgggccca
ctcaatgccatctatcaggctaaattcctgaaatatctggaacaccgtggtctgaaagat
acctccggtcagaccgtttacgctttcctgggcgacggcgagatggatgagccagaatcc
aaaggtgcgatcaccatcgccacccgtgaaaaactggataacctggttttcatcatcaac
tgtaacctgcagcgtctggatggaccggtcaccggtaacggtaagatcatcaacgagctg
gaaggcatttttgccggtgctggctgggaagtgatcaaggttatctggggcggtcgttgg
gatgaactgctgcgtaatgacaccagcggtaaactgatccagctgatgaacgaaaccgtt
gacggcgactaccagacgtttaagtcacgtgatggtgcctatgtgcgtgagcacttcttc
ggcaaatatccggaaaccgctgccctggtgaaagactggtcagatgatgaaatctgggca
ctgaaccgtggtggtcacgatccgaagaagatctatgcggcactgaaaaaagcgcaggac
accaaaggcaagcctgttctgatcctggcgcataccattaaaggttatggtatgggcgac
accgccgaaggtaagaacatcgcgcaccaggtgaagaagatgaacatggatggcgttcgc
tacatccgcgatcgcttcaacgtgccggtcgaagacgacaagatcgaatctctgccttac
atcaccttcgataaaggctctgaagagtacaactacctgcacggccagcgtgagaagtta
ggcggttacctgccatcacgtcagccgaggttcactgaaaagctggaaatgccagcgctg
gaagagttcagtgcgctgctggaagagcagaacaaagagatctctaccaccatcgcgttc
gtgcgtgcactgaatgtgatgctgaagaacaaatcgatcaaagatcgcctggtgcctatc
cttgcggatgaagcccgtactttcggtatggaaggcctgttccgtcagattggtatctac
agcccgaacggtcagcagtacacaccgcaggaccgtgagcaggtggcttactataaagaa
gacgagaaaggtcagattctgcaggaaggcattaacgagctgggcgcaggatcatcctgg
ctggcggcggcaacctcttacagcaccaacaacctgccgatgattccgttctacatctat
tattcgatgttcggattccagcgtattggcgatctgatgtggctggcgggcgaccaacag
gcgcgtggcttcctggtcggcggtacatcaggccgtaccaccctgaacggcgaaggtttg
cagcatgaagatggccacagccatattcagtcactgacgatccctaactgtatctcctac
gatccgtcgtatgcctacgaagtggcagtcatcatgcatgacggtctggttcgtatgtac
ggcgaagcgcaggaaaatatttattactacatcaccacgctgaacgaaaactaccacatg
ccagcgatgccgaaaggtgccgaggaaggtatccgtaaaggtatctacaagctggaaacc
gttgagggtagcaaaggtaaagttcagctcttgggttcaggctctatcctgcgtcacgtg
cgtgaagctgcccagattctggcgaccgattacggcattggttcagacgtttacagcgtc
acctcgttcaccgagctggcccgcgatggtcaggactgtgagcgctggaacatgctgcat
ccaacggaagccccacgcgtgccttacatcgctcaggtgatgaacgaagcgccagccgtg
gcctccaccgactacatgaagctgttcgctgagcaggttcgcagctatgtgccttcaagc
gattaccgcgtgctgggtacggatggctttggccgctctgacagtcgtgaaaatctgcgt
caccactttgaagtggatgcatcttacgttgtggttgccgcgctgggtgaactggctaaa
cgtggcgaaatcgataagaaagtcgtggcggatgcgatcgtgaagttcaagatcgatgcc
gataaagttaacccgcgtctggcttaa

KEGG   Pantoea ananatis LMG 20103: PANA_0744Help
Entry
PANA_0744         CDS       T01195                                 

Gene name
aceF
Definition
(GenBank) AceF
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00020  Citrate cycle (TCA cycle)
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0744 (aceF)
   00020 Citrate cycle (TCA cycle)
    PANA_0744 (aceF)
   00620 Pyruvate metabolism
    PANA_0744 (aceF)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PANA_0744 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: ADD75911
UniProt: D4GK82
Position
869189..871087
Genome map
AA seq 632 aa AA seqDB search
MAIEIKVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
TGDKVETGSLIMMFDAEGAAEAAPAPAQEKKAEAAPAAAPASASKDVNVPDIGGDEVEVT
EILVKVGDKVEAEQSLIVVEGDKASMEVPAPFAGVVKEITIATGDKVSTGSAIMVFEAEG
AAPASDAKPDVKEEAASAPAAAAGAKDVNVPDIGGDEVEVTEILVKVGDKVEAEQSLIVV
EGDKASMEVPAPFAGIVKELKVATGDKVSTGSLIMVFEVEGAAPAAPAAAKQEAAPAPAA
KSEAKAAAAPAAAKTESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILKE
DVQAYVKDAVKRAEAAPAAASGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSR
NWVMIPHVTHFDKTDITELEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFN
SSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGITELSRELMAISKKARDGKL
TAGDMQGGCFTISSLGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFAPRLMMPIS
LSFDHRVIDGADGARFITIIGNMLSDIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcaaggtaccagatatcgggtcagacgaagttgaagtcaccgaaatt
ctggtcaaggttggcgacaaggtggaagccgagcagtcgctgatcaccgtggaaggcgat
aaagcctctatggaagttccctcgccgcaggctggcgtggtgaaagagatcaaaatcgca
accggtgacaaagtggaaaccggttcgctgatcatgatgtttgatgctgaaggcgctgcg
gaagcagcccctgcgcccgcgcaggagaaaaaagcagaggccgcgccagccgctgcacct
gccagtgccagcaaagacgttaacgtgccggacatcggcggtgacgaagttgaagtcact
gagattctggttaaggttggcgataaagtcgaagccgagcagtcacttattgtcgtcgaa
ggtgacaaagcgtcaatggaagttccggctccgttcgcgggtgtggtcaaagagatcacc
attgcgaccggcgacaaagtcagcaccggttcagccatcatggtctttgaagcagaaggt
gcagcaccggcctctgatgcgaagccagacgtgaaagaagaagcggcatcggcacctgcc
gcggctgcgggcgcaaaagacgttaacgttccggatatcgggggagacgaagttgaagtc
accgagatcctcgttaaggttggcgacaaggtggaagccgagcagtcactgatcgttgtt
gaaggcgacaaagcctctatggaagtgccagcaccgtttgcgggtatcgtcaaagagctg
aaagtcgcgacgggcgataaagtcagcaccggctcactgattatggtcttcgaagttgaa
ggtgctgctccggctgcccctgcggctgcgaaacaggaagccgcaccggcgcctgctgcc
aaatctgaagcgaaagccgcagcagcacctgccgccgctaaaacagagagcaaaggtgag
ttcgcagagaacgacgcttacgttcacgctaccccggtcattcgtcgtctggcgcgtgaa
tttggcgttaacctggccaaagttaaaggcacaggccgtaaaggtcgtattctgaaagaa
gacgttcaggcttacgttaaagatgccgtgaaacgcgcagaagccgcgccagccgccgcc
agcggtggcggcctgccgggcatgctgccatggccgaaggttgacttcagtaagtttggg
gaagttgaagaagtggagctgggccgtatccagaaaatctcaggtgcgaacctgagccgt
aactgggtcatgatcccacacgttacgcacttcgacaaaaccgatattaccgagcttgaa
gctttccgtaagcagcagaacgccgaagcggagaagcgtaagctggacgtgaaatacacg
ccagtggtcttcatcatgaaagcggtggcggcggcgcttgagcagatgccacgctttaac
agctcactgtctgaagatgcgcagaagctgacgctgaaaaagtacatcaacatcggtgtg
gcggtggatactccaaatggcctggtggttccggtctttaaagacgtgaacaagaagggc
atcacagaactgtctcgtgaactgatggcgatctctaaaaaggcgcgcgatggcaaacta
accgcaggcgacatgcagggcggctgtttcaccatctccagccttggcggcctgggcacc
acccactttgcgccgattgttaacgcgccagaagtggccatccttggtgtgtcaaagtca
gcgatggagccagtgtggaacggtaaagagtttgcaccacgtctgatgatgccaatctct
ctgtccttcgatcaccgcgttatcgacggtgcagatggcgcacgtttcattaccattatt
ggcaatatgctgtcagacattcgtcgtctggttatgtaa

KEGG   Pantoea ananatis LMG 20103: PANA_0745Help
Entry
PANA_0745         CDS       T01195                                 

Gene name
lpdA
Definition
(GenBank) LpdA
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00020  Citrate cycle (TCA cycle)
pam00260  Glycine, serine and threonine metabolism
pam00280  Valine, leucine and isoleucine degradation
pam00310  Lysine degradation
pam00380  Tryptophan metabolism
pam00620  Pyruvate metabolism
pam00630  Glyoxylate and dicarboxylate metabolism
pam00640  Propanoate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0745 (lpdA)
   00020 Citrate cycle (TCA cycle)
    PANA_0745 (lpdA)
   00620 Pyruvate metabolism
    PANA_0745 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    PANA_0745 (lpdA)
   00640 Propanoate metabolism
    PANA_0745 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_0745 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    PANA_0745 (lpdA)
   00310 Lysine degradation
    PANA_0745 (lpdA)
   00380 Tryptophan metabolism
    PANA_0745 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pam04147]
    PANA_0745 (lpdA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     PANA_0745 (lpdA)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PANA_0745 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored AlaDh_PNT_C FAD_binding_2 NAD_binding_8 HI0933_like Thi4 FAD_binding_3 3HCDH_N Lycopene_cycl DAO
Motif
Other DBs
NCBI-ProteinID: ADD75912
UniProt: D4GK83
Position
871368..872795
Genome map
AA seq 475 aa AA seqDB search
MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHV
AKVIEEAKALEEHGIVFGQPQTDINKIRSWKEKVINQLTGGLSGMAKGRKVKVVNGLGKF
TGANTLVVEGEGGATTINFDNAIIAAGSRPIELPFIPHEDPRVWDSTDALELKEVPKRLL
VMGGGIIGLEMATVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRISKKFNLMLETKVT
AVEAKDDGIYVSMEGKKAPGEAQRYDAVLVAIGRVPNGKGMDADKAGVEVDDRGFIRVDK
QMRTNVPHIYAIGDIVGQPMLAHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAW
VGLTEKEAKEKGISYETATFPWAASGRAIASDCADGITKLIFDKETHRVIGGAIVGTNGG
ELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNAKAKKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtacagagattaaaactcaggtcgtggtacttggggcaggtcctgcaggttac
tctgcagcttttcgttgcgctgacttaggtctggaaaccgtactggttgagcgctacagc
accctcggcggtgtctgtcttaacgtaggctgtatcccgtctaaagcgctactgcacgtt
gccaaagtgattgaagaagcgaaagcgctggaagaacacggcattgtgtttggtcagccg
caaacggatatcaacaaaatccgcagctggaaagagaaggtgattaaccagctgactggc
ggtctgtcaggcatggcaaaaggtcgtaaagtcaaggttgttaacggcctgggcaaattt
accggtgcgaatacgctggtggttgaaggtgaaggtggtgcaaccaccattaacttcgac
aacgccattatcgctgcgggctcacgcccaatcgagctgccgttcattcctcatgaagat
cctcgcgtgtgggattcaaccgatgcgctggaactgaaagaagtgcctaaacgtctgctg
gtcatgggcggcggtattatcggtctggaaatggcgacggtttaccatgcgctgggttca
gagatcgacgtggttgaaatgttcgaccaggttatcccggctgccgataaagacgtggtg
aaagtcttcaccaaacgtatcagcaagaaattcaacctgatgctggaaactaaggtgacc
gccgttgaagcaaaagacgacggtatctatgtgtcaatggaaggtaaaaaagcgccaggc
gaagcccagcgttatgatgcggttctggtggcaattggtcgcgtgccaaacggtaagggc
atggatgcagataaagccggcgttgaggttgacgaccgtggctttatccgcgttgacaaa
caaatgcgcaccaacgtgccgcacatctacgctatcggcgatatcgtcgggcagccgatg
ctggcgcataaaggcgtgcatgaaggccacgttgcggcagaagtcatttcaggtctgaag
cactacttcgatccgaaagtgattccgtccattgcctatactgaaccagaagttgcctgg
gtaggtctgaccgagaaagaagcgaaagagaaaggcatcagctacgaaactgccacattc
ccgtgggctgcatccggccgtgctattgcttctgactgcgcagacggtatcaccaaactg
attttcgacaaagaaacccatcgcgttatcggtggcgccatcgttggtactaacggcggt
gagctgctgggcgaaattggtctggccattgaaatgggctgtgatgcagaagacatcgca
ttgaccatccatgcgcacccgaccctgcatgagtcagtaggcctggccgctgaaatcttt
gaaggcagcatcaccgatctgcctaacgcgaaagcgaaaaagaaataa

DBGET integrated database retrieval system