KEGG   Pantoea ananatis LMG 20103: PANA_0744Help
Entry
PANA_0744         CDS       T01195                                 

Gene name
aceF
Definition
(GenBank) AceF
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00020  Citrate cycle (TCA cycle)
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01200  Carbon metabolism
Module
pam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0744 (aceF)
   00020 Citrate cycle (TCA cycle)
    PANA_0744 (aceF)
   00620 Pyruvate metabolism
    PANA_0744 (aceF)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PANA_0744 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: ADD75911
UniProt: D4GK82
Position
869189..871087
Genome map
AA seq 632 aa AA seqDB search
MAIEIKVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
TGDKVETGSLIMMFDAEGAAEAAPAPAQEKKAEAAPAAAPASASKDVNVPDIGGDEVEVT
EILVKVGDKVEAEQSLIVVEGDKASMEVPAPFAGVVKEITIATGDKVSTGSAIMVFEAEG
AAPASDAKPDVKEEAASAPAAAAGAKDVNVPDIGGDEVEVTEILVKVGDKVEAEQSLIVV
EGDKASMEVPAPFAGIVKELKVATGDKVSTGSLIMVFEVEGAAPAAPAAAKQEAAPAPAA
KSEAKAAAAPAAAKTESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILKE
DVQAYVKDAVKRAEAAPAAASGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSR
NWVMIPHVTHFDKTDITELEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFN
SSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGITELSRELMAISKKARDGKL
TAGDMQGGCFTISSLGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFAPRLMMPIS
LSFDHRVIDGADGARFITIIGNMLSDIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcaaggtaccagatatcgggtcagacgaagttgaagtcaccgaaatt
ctggtcaaggttggcgacaaggtggaagccgagcagtcgctgatcaccgtggaaggcgat
aaagcctctatggaagttccctcgccgcaggctggcgtggtgaaagagatcaaaatcgca
accggtgacaaagtggaaaccggttcgctgatcatgatgtttgatgctgaaggcgctgcg
gaagcagcccctgcgcccgcgcaggagaaaaaagcagaggccgcgccagccgctgcacct
gccagtgccagcaaagacgttaacgtgccggacatcggcggtgacgaagttgaagtcact
gagattctggttaaggttggcgataaagtcgaagccgagcagtcacttattgtcgtcgaa
ggtgacaaagcgtcaatggaagttccggctccgttcgcgggtgtggtcaaagagatcacc
attgcgaccggcgacaaagtcagcaccggttcagccatcatggtctttgaagcagaaggt
gcagcaccggcctctgatgcgaagccagacgtgaaagaagaagcggcatcggcacctgcc
gcggctgcgggcgcaaaagacgttaacgttccggatatcgggggagacgaagttgaagtc
accgagatcctcgttaaggttggcgacaaggtggaagccgagcagtcactgatcgttgtt
gaaggcgacaaagcctctatggaagtgccagcaccgtttgcgggtatcgtcaaagagctg
aaagtcgcgacgggcgataaagtcagcaccggctcactgattatggtcttcgaagttgaa
ggtgctgctccggctgcccctgcggctgcgaaacaggaagccgcaccggcgcctgctgcc
aaatctgaagcgaaagccgcagcagcacctgccgccgctaaaacagagagcaaaggtgag
ttcgcagagaacgacgcttacgttcacgctaccccggtcattcgtcgtctggcgcgtgaa
tttggcgttaacctggccaaagttaaaggcacaggccgtaaaggtcgtattctgaaagaa
gacgttcaggcttacgttaaagatgccgtgaaacgcgcagaagccgcgccagccgccgcc
agcggtggcggcctgccgggcatgctgccatggccgaaggttgacttcagtaagtttggg
gaagttgaagaagtggagctgggccgtatccagaaaatctcaggtgcgaacctgagccgt
aactgggtcatgatcccacacgttacgcacttcgacaaaaccgatattaccgagcttgaa
gctttccgtaagcagcagaacgccgaagcggagaagcgtaagctggacgtgaaatacacg
ccagtggtcttcatcatgaaagcggtggcggcggcgcttgagcagatgccacgctttaac
agctcactgtctgaagatgcgcagaagctgacgctgaaaaagtacatcaacatcggtgtg
gcggtggatactccaaatggcctggtggttccggtctttaaagacgtgaacaagaagggc
atcacagaactgtctcgtgaactgatggcgatctctaaaaaggcgcgcgatggcaaacta
accgcaggcgacatgcagggcggctgtttcaccatctccagccttggcggcctgggcacc
acccactttgcgccgattgttaacgcgccagaagtggccatccttggtgtgtcaaagtca
gcgatggagccagtgtggaacggtaaagagtttgcaccacgtctgatgatgccaatctct
ctgtccttcgatcaccgcgttatcgacggtgcagatggcgcacgtttcattaccattatt
ggcaatatgctgtcagacattcgtcgtctggttatgtaa

DBGET integrated database retrieval system