KEGG   Pantoea ananatis LMG 20103: PANA_0760Help
Entry
PANA_0760         CDS       T01195                                 

Gene name
hpt
Definition
(GenBank) Hpt
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_0760 (hpt)
Enzymes [BR:pam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     PANA_0760 (hpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ADD75927
UniProt: D4GK98
Position
891483..892019
Genome map
AA seq 178 aa AA seqDB search
MKHTVDVMIPEQAIAARIAELGKEITDHYRDSGSDMVLVGLLRGSFMFMADLCRVIDVPH
EVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILRLREP
KSLAICTLLDKPERREVNVNVEYVGFSIPDEFVVGFGIDYAQHYRHLPYIGKVVPLED
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatactgttgacgtaatgatccctgaacaggcaatcgccgcgcgcatcgccgaa
ctgggcaaagaaatcaccgaccattaccgcgacagcggcagtgatatggtgctggtgggg
ctacttcgtggctcatttatgtttatggctgatttatgccgcgtcattgatgtcccgcac
gaagtggattttatgaccgcatccagttacggcagcggtatgtccacgacccgggatgtg
aaaatcctgaaagacctggatgaagatattcgcggcaaagatgttttaattgtcgaagac
attatcgactccggtaacacgctttcgaaagtgcgtgaaatcctgcgcttgcgtgagcca
aaatccctggcgatttgtacgctgctggataagcctgaacgtcgggaagtcaacgtcaac
gttgaatacgtcggcttttctattcccgatgagtttgtggtgggctttggtattgattat
gcgcaacattatcgccacctgccttacatcggcaaagtggtgccgctcgaagactga

KEGG   Pantoea ananatis LMG 20103: PANA_0888Help
Entry
PANA_0888         CDS       T01195                                 

Gene name
gpt
Definition
(GenBank) Gpt
  KO
K00769  xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_0888 (gpt)
Enzymes [BR:pam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     PANA_0888 (gpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran
Motif
Other DBs
NCBI-ProteinID: ADD76055
UniProt: D4GL09
Position
1028631..1029359
Genome map
AA seq 242 aa AA seqDB search
MRQFRHDKSPVSVRRPGRTLRSSSERSPSVYRRDRARISLFLTRCDIQRVKKPQPEARCW
FLARHVLIISRNLFPVAHFLSHTDWLGYLFMSEKYVVTWDMLQIHARKLAQRLLPVEQWK
GIIAVSRGGLVPASLLARELGIRYVDTVCISSYDHDHQREMKVLKRAEGDGEGFIVIDDL
VDTGGTAQAIREMYPKARFCTIFAKPAGRELVDDYIVDIPQNTWIEQPWDMGVVYIPPIV
KS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaattcagacacgacaagtctcctgtgtcagtgcgccggccaggccggacattg
cgaagttccagtgaaagatcgccgtcagtataccgaagagatagggcgagaatatcactg
tttctcacccggtgtgatattcaacgcgttaaaaagccgcaaccagaagccaggtgctgg
tttttagcgcgtcatgtccttataatctcgcgcaaccttttccccgttgcacatttttta
agccacactgactggctgggatacctatttatgagcgaaaaatacgtcgttacctgggac
atgctgcagattcatgcccgtaaactggctcaacgcctgcttcctgttgaacagtggaaa
ggcatcattgcagtcagccgcggcggtctggtaccggcttcgctgctggcacgtgaactg
ggtattcgctatgtcgataccgtttgtatttccagctacgatcacgatcaccagcgcgaa
atgaaagtgttaaagcgcgctgaaggcgatggcgaaggctttatcgtgattgacgacctg
gttgataccggcggcaccgcacaggccattcgcgaaatgtacccaaaagcccgtttctgc
accatttttgctaagcctgcgggccgtgagctggttgacgattatatcgttgatatccct
cagaacacctggattgagcagccatgggacatgggcgtggtctatattccgccgattgta
aaaagctga

DBGET integrated database retrieval system