KEGG   Pantoea ananatis LMG 20103: PANA_0764Help
Entry
PANA_0764         CDS       T01195                                 

Gene name
panD
Definition
(GenBank) PanD
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00410  beta-Alanine metabolism
pam00770  Pantothenate and CoA biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Module
pam_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA_0764 (panD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PANA_0764 (panD)
Enzymes [BR:pam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     PANA_0764 (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_decarbox
Motif
Other DBs
NCBI-ProteinID: ADD75931
UniProt: D4GKA2
Position
complement(894611..894991)
Genome map
AA seq 126 aa AA seqDB search
MIRTVLQGKLHRVKVTQADLNYEGSCAIDQDFLDASGILQYEAIDIYNVTNGQRFSTYAI
AAERGSKIISVNGAAARCACEGDILIICSYVQVEDAEARQWKPNVAYFEGDNQMKRLAKA
LPVQLA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcacggttttacaaggcaaattgcatcgcgtgaaggtgacgcaggcagacctc
aactatgaaggctcctgcgccatcgatcaggatttccttgatgcttctggcatcctgcaa
tacgaagccatcgatatttacaacgtgaccaacggtcagcgtttctctacctatgctatc
gccgccgaacgaggttcaaaaatcatttcggtcaacggcgcagcggcgcgctgtgcctgt
gaaggcgatatcctgattatctgctcctatgtgcaggttgaagatgcagaagcccgtcag
tggaagcccaacgtggcctactttgaaggggataatcagatgaagcgcctggcgaaagcc
ttgccggtacagttggcgtaa

DBGET integrated database retrieval system