KEGG   Pantoea ananatis LMG 20103: PANA_0809Help
Entry
PANA_0809         CDS       T01195                                 

Gene name
accA
Definition
(GenBank) AccA
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00061  Fatty acid biosynthesis
pam00620  Pyruvate metabolism
pam00640  Propanoate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01212  Fatty acid metabolism
Module
pam_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PANA_0809 (accA)
   00640 Propanoate metabolism
    PANA_0809 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PANA_0809 (accA)
Enzymes [BR:pam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PANA_0809 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PANA_0809 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: ADD75976
UniProt: D4GKE7
Position
946454..947410
Genome map
AA seq 318 aa AA seqDB search
MSLNYLDFEQPIAELEAKIDSLTSIGRQDDKHVNLDEEVKRLREKSVELTRKIFADLGAW
QIAQLARHPLRPYTFDYVRNAFDDFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKG
RETKEKIRRNFGMPAPEGYRKALRLMEMAERFKMPILTFIDTPGAYPGVGAEERGQSEAI
ARNLREMSGLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSA
DKAPLAAEAMGITAPRLKELKLIDSVIPEPLGGAHRHPVEMAQSLKQQLLADLADLEGLS
TEELLDRRYQRLMSYGYA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttaattacctggattttgaacagccaattgcagaactggaagcgaagattgat
tcgctaacctcgattggtcgtcaggacgataaacacgtcaatctcgacgaagaagtgaag
cgactgcgcgagaaaagcgttgagctgacccgtaaaatcttcgccgatttgggcgcatgg
caaattgcacaactggcacgccatccgctacgtccttatacctttgattacgtgcgcaat
gcctttgacgatttcgatgagctggcgggtgaccgtgcttatgcggatgacaaagccatt
gtgggcgggattgcgcgccttgatggtcgcccggtcatgatcattggtcaccagaaagga
cgtgaaaccaaagagaagattcgccgtaattttggcatgccagcaccagaaggctatcgc
aaagcgctgcgcctgatggaaatggctgagcgtttcaagatgccaatcctgacctttatc
gacacgccgggcgcttatcctggcgttggtgcggaagagcgtggtcagtctgaggcaatt
gcccgtaatctacgggaaatgtccggtctgaaggtgcctgtgatctgtacggtcatcggt
gaaggcggctccggtggtgcgctggccattggtgtgggtgataaagttaacatgctgcag
tacagcacttactctgttatctctccggaaggctgtgcctctattctgtggaaaagcgcc
gataaagcgcctctggcagccgaagcgatgggtattaccgcgccgcgtctgaaagagctg
aagctgattgactcggttatccctgagccactgggcggggcgcatcgtcatcctgtcgaa
atggcgcagtcgctgaaacagcaactgctggccgatctggccgatctggaagggctcagc
accgaagaactgctcgatcgccgttatcaacgtctgatgagctacggctacgcctga

KEGG   Pantoea ananatis LMG 20103: PANA_2668Help
Entry
PANA_2668         CDS       T01195                                 

Gene name
accD
Definition
(GenBank) AccD
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00061  Fatty acid biosynthesis
pam00620  Pyruvate metabolism
pam00640  Propanoate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01212  Fatty acid metabolism
Module
pam_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PANA_2668 (accD)
   00640 Propanoate metabolism
    PANA_2668 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PANA_2668 (accD)
Enzymes [BR:pam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PANA_2668 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PANA_2668 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC Tmemb_55A OrfB_Zn_ribbon DZR Zn-ribbon_8 zf-FPG_IleRS Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: ADD77835
UniProt: D4GJ85
Position
complement(3005372..3006286)
Genome map
AA seq 304 aa AA seqDB search
MSWIERILNKSNITPTSRASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMHAR
ERLASLLDQGTLVELGSELEPKDLLKFRDSKKYKDRLVAAQKATNEKDALIVMKGQLHGM
PVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMA
KTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVR
EKLPPGFQRSEFLIEKGAIDMIIRRPEMRYKLASLLAKMMNLPAPLHDGEAFAPATSHPE
SNEA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgcattcttaataaaagcaacattacgcccacaagtcgcgccagt
attccggaaggggtgtggacgaaatgcgacagctgtggccaggtactttatcgtgccgag
ctggagcgtaatcttgaggtctgccctaagtgcgaccaccacatgcgcatgcatgcccgt
gagcgcctggcgagcctgctcgatcagggcacgctggttgagctgggcagcgagctggaa
cccaaggatctgttgaagttccgggattccaaaaagtataaagatcgtctggttgctgca
cagaaagccacgaatgagaaagatgcgctgatcgtgatgaaaggtcagctgcacggtatg
ccggttgtggcggccgcctttgaattcgcctttatgggcggctcaatgggatcggtggtt
ggcgcacgtttcgtccgggctgttgagcaggcgctggaagataactgcccgctgatctgc
ttctccgccagtggcggtgcgcgtatgcaggaagcgttaatgtcgctgatgcagatggcc
aaaaccagtgccgcgctggcgaaaatgcaggaacgcggtctgccgtatatttcggttttg
accgacccgaccatgggcggcgtgtctgccagctttgcgatgctgggcgatctgaatatt
gccgaacctaaagccctgatcggctttgcgggtccacgtgtgattgagcagaccgttcgt
gaaaaactgccgccgggcttccagcggagtgagtttttgatcgagaaaggggcgattgat
atgatcattcgtcgtccggaaatgcgctataaactggcgagtctgctggcaaaaatgatg
aatctgcccgcaccgctgcacgacggtgaagcgttcgcacctgcgacgagccatccggag
agcaacgaggcctga

KEGG   Pantoea ananatis LMG 20103: PANA_3571Help
Entry
PANA_3571         CDS       T01195                                 

Gene name
accB
Definition
(GenBank) AccB
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00061  Fatty acid biosynthesis
pam00620  Pyruvate metabolism
pam00640  Propanoate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01212  Fatty acid metabolism
Module
pam_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PANA_3571 (accB)
   00640 Propanoate metabolism
    PANA_3571 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PANA_3571 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H YqfD
Motif
Other DBs
NCBI-ProteinID: ADD78738
UniProt: D4GCC7
Position
3975083..3975547
Genome map
AA seq 154 aa AA seqDB search
MDIRKIKKLIELVEESGISELEISEGEESVRISRAPANTGYPMMQQAYAAPVAQQPALAT
AVAPVAAVAEAAPAEISGHIVRSPMVGTFYRTPSPDAKAFVEVGQKVNAGDTLCIVEAMK
MMNQIEADKSGVVKAILVESGQPVEFDEPLVVIE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatattcgtaaaattaaaaaactgatcgaactggttgaagaatctggcatttctgag
ctggaaatctccgaaggcgaagagtctgttcgcatcagtcgcgcacctgcaaataccggt
tacccaatgatgcaacaggcttatgccgcgccggttgctcaacagcctgctctggcgaca
gccgttgcacctgttgccgccgttgcagaagccgcgcctgctgagatcagcggccacatc
gtacgttcaccaatggtaggaaccttctatcgcacaccaagcccggatgcaaaagcgttc
gtggaagtgggtcagaaagtcaatgcaggtgacacgctgtgcatcgttgaagccatgaaa
atgatgaaccagattgaagcggataagtctggcgttgttaaagccattctggtggaaagt
ggtcagccggtagaatttgacgagccacttgttgtcatcgaataa

KEGG   Pantoea ananatis LMG 20103: PANA_3572Help
Entry
PANA_3572         CDS       T01195                                 

Gene name
accC
Definition
(GenBank) AccC
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00061  Fatty acid biosynthesis
pam00620  Pyruvate metabolism
pam00640  Propanoate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01212  Fatty acid metabolism
Module
pam_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PANA_3572 (accC)
   00640 Propanoate metabolism
    PANA_3572 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PANA_3572 (accC)
Enzymes [BR:pam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PANA_3572 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PANA_3572 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp GARS_A RimK ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADD78739
UniProt: D4GCC8
Position
3975559..3976908
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAQSVKSY
LNIPALISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFVGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGSLTDDMEKNRAFAKRIGYPVIIKASGGGGGRGMRVVRSDKDLEQ
SINMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNAIYLGERDCSMQRRHQKVV
EEAPAPGITPELRSFIGERCTRACIDIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEDVIIRGHAVECRINAEDPVSFLPSPGKITRFHAP
GGFGVRWESHIYAGYSVPPYYDSMIGKLITYGETRDIAIARMKNALAELIIDGIKTNIEL
QMKIMSDENFQQGGTNIHYLEKKLGLHEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgttattgctaaccgcggtgagattgcgctgcgcattctgcgtgcc
tgtaaagaactgggcatcaagactgtcgcggtccattcaagcgcggatcgtgacctgaag
cacgtgctgctggcagacgaaacggtttgcatcggcccggcgcagtcggtcaaaagttac
ctcaacatcccggcgctgatttctgccgctgagatcaccggcgcggtggcgattcacccc
ggctacggcttcctttctgagaacgccgattttgctgagcaggttgagcgttctggcttt
atcttcgtcggtccgaaagccgataccattcgcctgatgggcgataaagtgtccgcgatt
accgcgatgaagaaagcgggcgttcctaccgtccccggctccgatggctcgctcaccgat
gacatggaaaaaaaccgtgccttcgccaagcgcatcggctatccggttattatcaaagcc
tctggcggcggcggcggtcgcggcatgcgcgttgtgcgtagcgataaagatctggaacaa
tccatcaacatgacgaaagcggaagccaaagcggctttcaacaacgacatggtttacatg
gaaaagtatctggagaatccacgccatatcgagattcaggtactggccgacggccagggc
aatgccatttatctgggcgaacgcgactgttcaatgcagcgtcgtcaccagaaggtcgtg
gaagaagcgccagcaccggggatcacgccagaattgcgttccttcatcggtgagcgttgc
acccgagcctgtattgatattggctatcgcggggcaggtacgtttgaattcctgtatgaa
aacggcgagttctatttcattgaaatgaacacccgtatccaggttgagcatccggttacc
gagatgatcaccggcgttgacctgattaaagagcagctgcgtattgctgcgggtcagccg
ctgtcaatcaagcaggaagacgtgattattcgcggtcatgcggtcgagtgccgtatcaac
gcggaagatccggttagcttcctgccaagcccgggcaaaatcacccgcttccatgcgccg
ggtggttttggcgtgcgttgggaatctcatatttatgccggttacagcgtaccgccttat
tatgactccatgattggcaagttaatcacctacggtgaaacccgcgatatcgccattgca
cgtatgaaaaatgccctggcggagctgattatcgacggtatcaaaaccaacatcgaactg
cagatgaaaatcatgtccgatgagaacttccagcagggtggaaccaatatccactatctg
gagaaaaagcttggcctgcacgagaagtaa

DBGET integrated database retrieval system