KEGG   Pantoea ananatis LMG 20103: PANA_0945Help
Entry
PANA_0945         CDS       T01195                                 

Gene name
aroL
Definition
(GenBank) AroL
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_0945 (aroL)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PANA_0945 (aroL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_16 AAA_5 AAA_33 Cytidylate_kin2 AAA_28 AAA_25 AAA SMC_N Ploopntkinase3 AAA_14 PduV-EutP AAA_23 RNA_helicase AAA_22 AAA_21 Rad17 AAA_24
Motif
Other DBs
NCBI-ProteinID: ADD76112
UniProt: D4GL66
Position
1093783..1094358
Genome map
AA seq 191 aa AA seqDB search
MSLTCSCDGLRGGGTALMSLSIFLIGARGCGKTTIGEALSHALGYAFRDTDHHLQFTTQR
TVAEIVAAEGWESFRARETDSLKAVTAPSTIIATGGGMVLAEGNRRYMREHGQVIWLSAP
PDILARRLESQPENAQRPTLTGRPIAEEMGEVLRARAHLYRSAAHHEVNAMLAPERVVEQ
ILQSLSLARAS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgagcctaacctgcagctgtgatgggctgcgcggcggaggaactgccctgatgtccttg
tccatttttttgatcggtgcgcgcggatgcggaaaaaccactatcggtgaagccctgtct
catgcgctgggttatgcgtttcgcgataccgatcatcacctgcaattcacgacgcagcgt
accgtagcggaaattgtggctgcggaaggatgggagagctttcgtgcgcgtgaaaccgac
tcgctcaaagccgtaaccgccccgtcaaccattatcgccaccggtggcggaatggtgctg
gcggaaggtaatcgccgttatatgcgtgagcacggtcaggtgatctggttaagtgcaccg
cctgatatcctggctcgtcgtctggaaagccagccggaaaatgctcagcgccccacgtta
accggacgccccatcgcggaagaaatgggtgaagtgctgcgcgcccgtgcgcacctgtac
cgttctgccgcgcatcacgaggtgaacgccatgctggcacctgaacgcgtcgttgaacag
atcctgcagtcgttatctctggcgcgtgccagttaa

KEGG   Pantoea ananatis LMG 20103: PANA_3668Help
Entry
PANA_3668         CDS       T01195                                 

Gene name
aroK
Definition
(GenBank) AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_3668 (aroK)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PANA_3668 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE ABC_tran APS_kinase AAA_5 AAA_7 AAA_25 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_PrkA AAA_28 AAA_29 His_biosynth RsgA_GTPase Mg_chelatase AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: ADD78835
UniProt: D4GCM4
Position
complement(4054488..4055009)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEAGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVESPPREVLEALAGERNPLYEEIADVTIRTDDQSAKVVANQIIHMLEKS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggccgatgggtgccggcaaaagcactatt
ggccgtcagttggctcagcaactcaatatggagttcttcgattccgatcaggaaattgag
cgacgcaccggagcggatgtgggctgggtttttgacgttgaaggcgaagctggcttccgc
gatcgtgaagaaaaaatcatcaatgaactgaccgagaagcagggcatcgtcctggcgacc
ggcggtggctccgtaaaatcccgggaaacacgtaatcgtctctccgctcgcggcgtcgtg
gtgtatcttgaaaccactattgagaaacaactggcacgtacacagcgtgataaaaaacgc
cccttactgcaggtagaatcaccgccgcgtgaagtgcttgaagcgctggcaggtgaacgt
aacccgctttatgaagagatcgccgacgtcactatccgcactgacgatcaaagtgcaaaa
gtggtggcgaatcagattatccacatgttggaaaaaagttga

DBGET integrated database retrieval system