KEGG   Pantoea ananatis LMG 20103: PANA_0984Help
Entry
PANA_0984         CDS       T01195                                 

Gene name
aldA
Definition
(GenBank) AldA
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0984 (aldA)
   00620 Pyruvate metabolism
    PANA_0984 (aldA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     PANA_0984 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADD76151
UniProt: D4GLA5
Position
1134134..1135654
Genome map
AA seq 506 aa AA seqDB search
MRYAHPGTPGALVTFKSAYGNYIDGKFIEPLSGEYFMNTSPVNGSDIARFPRSDARDIDL
ALDAAHRAAEAWGKTSVQTRSNLLLQVADRIDANLETLAVAESWDNGKPIRETLNADLPL
AADHFRYFAGCLRAQEGSTGEIDEKTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPLGITLLMEMIGDLFPAGVLNVVQGFGREAGEALATSKRIAKIAFTG
STPVGRHIMACAAENIIPCTVELGGKSPNIYFADIMNGEPDFIDKAVEGLVLGFFNQGEV
CTCPSRALIHESVYAPFMERVMAKVATIRRGDPLDTDTMIGAQASRQQFDKILSYIEIAR
NEGGEILTGGERALISSELDNGFYIQPTLIKGSNSMRCFQEEIFGPVIGITTFKDEAEAL
RIANETQFGLGAGVWTRDSNLAYRMGRAIKAGRVWTNCYHIYPAHAAFGGYKQSGVGRET
HKMALNQYQQTKNLLVSYDTAPLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgcccatcccggcacacctggtgcgttagtgacgtttaaatctgcctacggc
aactacattgatggcaaatttatcgagccgctgagtggtgagtacttcatgaatacgtca
cccgtcaacggcagtgacattgcccggtttcctcgttccgatgcgcgcgatattgattta
gcgctggatgccgcgcaccgggctgcagaagcctggggaaaaacctccgtacaaacccga
tctaatctgctgctccaggtggctgaccgcattgatgccaatctcgaaaccctggccgtg
gcggaaagctgggacaacggcaaaccgattcgggaaacgctcaatgccgatctgccgctg
gcggccgaccattttcgttacttcgcaggatgcctgcgcgcgcaggagggcagcaccggc
gagatcgatgaaaaaaccgtggcctaccattttcatgagccgctgggcgtggtggggcaa
attattccttggaattttccgttgctgatggccgcatggaagctggcgccggccctggct
gccggtaactgtgtggtgcttaagcctgcggagcaaactccgctgggcattacgctgctg
atggagatgatcggcgacctgtttcctgcaggcgtgctaaacgtggtacagggtttcggc
cgcgaggcgggcgaagcgttggcaaccagtaaacgcattgccaaaatcgccttcaccggt
tctacgccggtgggacgtcatatcatggcctgtgccgcagaaaatattattccctgtact
gtggagctgggcgggaaatctccaaacatctacttcgccgacatcatgaatggcgagccg
gactttattgacaaggcggtggaaggactggtgctgggcttctttaatcagggcgaggta
tgtacctgtccgtcccgtgcgctaatccatgagtccgtttacgcgcctttcatggagcgg
gtgatggccaaagtcgctaccattcgtcgcggcgatccgctcgataccgacacgatgatt
ggcgcccaggcttcgcgtcagcagttcgataaaattttgtcgtatatcgagattgcccgc
aacgaagggggcgagatcctgaccgggggtgagcgggccttgatatcgtccgaactggat
aacggtttctatattcagcccacgctgattaaaggcagcaacagcatgcgctgctttcag
gaggaaatctttggcccggttatcggcatcaccaccttcaaagatgaggctgaagccttg
cgtattgccaatgaaacccagtttggattgggagcgggcgtctggacgcgggacagcaat
ttagcctaccgcatggggcgcgccattaaagccgggcgcgtctggaccaactgttaccac
atctatccggcccatgctgcctttgggggttataaacagtccggcgtgggtcgcgaaaca
cacaaaatggcactcaaccagtaccagcagaccaaaaacctgttagtcagctatgacacg
gcaccgctggggctgttttga

KEGG   Pantoea ananatis LMG 20103: PANA_1562Help
Entry
PANA_1562         CDS       T01195                                 

Gene name
aldA
Definition
(GenBank) AldA
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1562 (aldA)
   00620 Pyruvate metabolism
    PANA_1562 (aldA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     PANA_1562 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADD76729
UniProt: D4GCQ6
Position
1752335..1753855
Genome map
AA seq 506 aa AA seqDB search
MRYAAPGESGSLITLQKHYGNFINGAFVAPVNGHYFTNTSPVNGSDAGAFPRSDKADVDN
AVAAAAAAADAWGKTSPQQRALVLLKIADRLEEKLEYLAVNETWDNGKPVRETLAADMPL
AVDHFRYFAGCVRAQEGSAAEIDEFTAAYHFHEPLGVVAQIIPWNFPLLMAAWKLAPALG
AGNCVVLKPAEQTPLSITLFVDLIKDLLPPGVVNVVHGYGKEAGEALASHPGIAKVAFTG
STATGGHILELAAKSLIPSTVELGGKSPNIFFEDIMQAEESFIEKAAEGVVLGFLNQGEV
CTCPSRALVQESIYEPFMAAVLKRIKTIKRGDPMDTETMVGAQASQQQFDKILSYLEIAR
QEGAEVLIGGGVETLDDTLASGYYIQPTLLKGNNSMRVFQEEIFGPVVGITTFKDEAEAI
AIANDSIYGLGAGVWTRDINRAYRVGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGIGRET
HKMMLDHYQQTKNLLVSYSIQPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatgccgctccaggagaatccggttctctcatcacgctgcaaaagcactatggc
aatttcatcaatggggcgttcgttgcgccggtcaatggccactacttcaccaatacctcg
cccgttaatggttcagatgccggggcgtttccccgctcagacaaggcagacgtcgataac
gcggtcgctgccgctgccgccgcggcggatgcctggggaaaaacctcgcctcagcagcgc
gccctggtgctgcttaaaatcgccgaccggctggaagagaagctggaatacctggcggta
aatgaaacctgggacaacggtaaaccggttcgtgaaacgctggccgccgatatgccgctg
gcggtggatcacttccgctattttgccggttgtgtcagggcgcaggagggcagcgcggcg
gagatcgacgaatttactgccgcctatcactttcatgaacccctgggcgtggtggcgcag
atcatcccgtggaactttccgctgctgatggcggcatggaagctggcgccggccctgggg
gcagggaactgcgtggtgctcaagcccgcggagcaaacgccgctgtcgattaccctgttt
gttgacctgattaaagatctgctgccgcccggcgtggtcaacgtggtccacggttatggt
aaagaagcgggtgaggcgctggcctcccatccgggcattgccaaagtggcatttacggga
tcgacggcgacgggcggccatatcctggaactggcggcgaaaagcttgattccgtctacg
gtcgaactgggcgggaaatcgccgaacatctttttcgaagatatcatgcaggccgaagaa
agctttattgaaaaagcggcggaaggggttgtgcttggcttcctgaatcagggtgaagtc
tgtacctgtccgtcgcgggcgctggtgcaggagtccatttacgagccctttatggcggca
gtgcttaaacgcattaaaaccatcaagcgcggcgatcccatggatacggaaacgatggtg
ggcgcgcaggcttctcagcagcagttcgataaaattctttcctatctggagatcgcccgt
caggaaggggccgaggtgctgatcggcggcggtgttgagacgctcgatgacacgctggcc
agcggctactacattcagccgacgctgctgaaaggcaacaacagcatgcgggtattccag
gaagagatctttggcccggtggtgggcatcaccaccttcaaggatgaggcagaggccatc
gccattgccaacgactccatctacggcctgggcgcgggcgtctggacacgggatatcaac
cgggcctaccgcgtcgggcgggcaatcaaagccggacgtgtctggacgaactgctatcac
ctttatcccgctcacgcggccttcggtggctataaaaaatcaggtatcggtcgcgagacg
cacaagatgatgcttgatcactatcagcagacgaaaaacctgttagtgagctacagcatc
cagccgcttggcttcttctga

KEGG   Pantoea ananatis LMG 20103: PANA_1940Help
Entry
PANA_1940         CDS       T01195                                 

Gene name
aldA
Definition
(GenBank) AldA
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00053  Ascorbate and aldarate metabolism
pam00071  Fatty acid degradation
pam00280  Valine, leucine and isoleucine degradation
pam00310  Lysine degradation
pam00330  Arginine and proline metabolism
pam00340  Histidine metabolism
pam00380  Tryptophan metabolism
pam00410  beta-Alanine metabolism
pam00561  Glycerolipid metabolism
pam00620  Pyruvate metabolism
pam00625  Chloroalkane and chloroalkene degradation
pam00903  Limonene and pinene degradation
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1940 (aldA)
   00053 Ascorbate and aldarate metabolism
    PANA_1940 (aldA)
   00620 Pyruvate metabolism
    PANA_1940 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PANA_1940 (aldA)
   00561 Glycerolipid metabolism
    PANA_1940 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA_1940 (aldA)
   00310 Lysine degradation
    PANA_1940 (aldA)
   00330 Arginine and proline metabolism
    PANA_1940 (aldA)
   00340 Histidine metabolism
    PANA_1940 (aldA)
   00380 Tryptophan metabolism
    PANA_1940 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA_1940 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PANA_1940 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA_1940 (aldA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PANA_1940 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADD77107
UniProt: D4GEY5
Position
complement(2168098..2169570)
Genome map
AA seq 490 aa AA seqDB search
MSDFDPDKVRLSTGHFINGQFVSASGKTMGIKRPSDGQHYADINEAGAETVGEAVSLAED
ARIRSGWSSCSPRERGAAISRWADLIDADKDYLAQLEAVGSTRPITDTINIEVPFTAAAL
RFYAECADKYSGDVFPTQNSSLGMLVPEPYGVIGAITPWNFPLSMASWKCGPALAAGNAV
VLKPSELTPFSTARLAELAVQAGIPPGVLNVVQGGGQVTGNALVTHPLVRKVSFTGSTAT
GAAIMSQAALHGTKPVTLELGGKSPQLVFDDAGDADEIAERLFLGFTVNAGQACVSGTRL
IIQQGIAERVIEKLIALCKTPLPGMTWQAATRYCPLIDQRQGEKVATIIAQSVAQGASIL
AGGQRYENTAQGWFWQPTLLANVNQDNVAIQEEIFGPVLTIQTFSDEEEALALAQHRVFG
LCAGVHTLNMPRAMRLMKALDSGTVWINRYRRTWDFIIPTGGFQGSGFGKDLGRQAFESC
QRYKSVLIDF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgatcccgataaggtccgtctttcgaccggacattttatcaacggccag
tttgtttcggcatccggcaaaacaatggggattaaacgtccctcggatggccagcattat
gccgacatcaacgaagcgggcgcagaaacggtcggcgaggcggtaagcctcgcggaagac
gcgcgcattcgcagcggctggtcaagctgctcgccacgcgaacggggcgcggccatttcc
cgctgggcggatttgatcgatgccgacaaagattatctggcgcagcttgaggcggtgggc
tccacgcgtccgataacggacacgatcaatattgaagtgcctttcaccgccgctgctctg
cgtttttatgcagaatgcgcagacaagtacagcggagatgtgtttccaacccagaacagt
agcctggggatgctggtgccggagccttatggcgtgatcggcgcgatcacgccgtggaat
ttcccgctgtcgatggcgtcgtggaagtgcggcccggcgctggctgcgggaaacgcggtg
gtactcaagccctctgagctgacgccattctccaccgcgcggctggctgagctggccgtg
caggccggtattccgcccggtgtgctcaacgtcgttcagggcggcggacaggtcaccggc
aatgcactggtgacccatcctctggtcagaaaggtgtcctttaccggttcaaccgcgacc
ggggcggcgatcatgagccaggccgcgttgcacggtaccaagcccgtgacgctggaactg
ggcggaaaaagcccgcagctggtttttgacgatgcaggcgatgcggatgaaatcgccgag
cgcctgtttctgggcttcaccgtcaacgccggtcaggcctgtgtttcagggacgcgtctg
atcattcaacaaggtatcgcagaacgggtcatcgaaaagcttatcgccctatgcaaaaca
ccgctgcccggtatgacctggcaggccgccacgcgttactgtccgctgatcgatcaacgt
cagggggaaaaagtcgcgacgattatcgcgcagtccgtggcgcagggggccagcattctg
gccggcggccagcgttacgaaaacaccgcgcagggctggttctggcaaccgacgctgtta
gccaatgtgaatcaggataacgtcgcgattcaggaggagatcttcggaccggtgctcacc
atccagacgtttagcgatgaagaagaagccctggcgctcgcacagcatcgcgtttttggc
ttatgtgcaggcgtgcatacgctcaacatgccacgtgcgatgcggctgatgaaagccctg
gacagcggtacggtctggatcaaccgctatcgtcgaacctgggactttatcattccaacc
ggcggctttcaggggtccggttttggcaaagatcttgggcgccaggcctttgagtcatgt
cagcgctacaagagtgtcttaatcgatttttaa

KEGG   Pantoea ananatis LMG 20103: PANA_2415Help
Entry
PANA_2415         CDS       T01195                                 

Gene name
betB
Definition
(GenBank) BetB
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00053  Ascorbate and aldarate metabolism
pam00071  Fatty acid degradation
pam00280  Valine, leucine and isoleucine degradation
pam00310  Lysine degradation
pam00330  Arginine and proline metabolism
pam00340  Histidine metabolism
pam00380  Tryptophan metabolism
pam00410  beta-Alanine metabolism
pam00561  Glycerolipid metabolism
pam00620  Pyruvate metabolism
pam00625  Chloroalkane and chloroalkene degradation
pam00903  Limonene and pinene degradation
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_2415 (betB)
   00053 Ascorbate and aldarate metabolism
    PANA_2415 (betB)
   00620 Pyruvate metabolism
    PANA_2415 (betB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PANA_2415 (betB)
   00561 Glycerolipid metabolism
    PANA_2415 (betB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA_2415 (betB)
   00310 Lysine degradation
    PANA_2415 (betB)
   00330 Arginine and proline metabolism
    PANA_2415 (betB)
   00340 Histidine metabolism
    PANA_2415 (betB)
   00380 Tryptophan metabolism
    PANA_2415 (betB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA_2415 (betB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PANA_2415 (betB)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA_2415 (betB)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PANA_2415 (betB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADD77582
UniProt: D4GHR5
Position
complement(2693278..2694777)
Genome map
AA seq 499 aa AA seqDB search
MMGVTNKDSSMLSFDPESVPLPLGHYIGGKHVQTQGESFAVKRPSDGRVFATLHEAQADD
VDRAVMTAHQALKTSGWSGCSPRERGRVLRRWADLIEQDLLLAQLEALGSTRPIADVVQH
EIPFTAEAIRFYAECADKYSGDLFPTRDSSLGMLIAEPYGVIGAITPWNFPLSMASWKCG
PALAAGNAVVLKPSELTPLSTVRMAELAVQAGLPAGILNIVQGSGAVTGSALVRHPQVRK
VSFTGSTLTGARIMSDAAQFGMKPVTLELGGKSPQLVFDDAGDIEVLAQRILRGFTANGG
QACVAGTRLIVQRGIADALTERLAALCREARPGVTWQDTSRYAPLIDARQGNKVRSVIED
AKAQGAEVLVGGERFADTDEGWFWQPTLLSQVKQDNPAVQQEIFGPVLTIQTFDDEEQGL
ALAAHDTYGLCAGVHTLSLPRAMRAIRAIDAGTVWVNRYGRSGDFIIPTGGFLGSGIGKD
LGRQAFQACQRQKSVLIDF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggtgtaacaaataaggattcttccatgttgagtttcgacccggaaagcgtgcca
ctcccgttaggccattatatcggcgggaaacatgtgcaaacacaaggcgaatcttttgcc
gttaaacgcccctcagatggtcgtgtttttgccaccctgcatgaagcccaggcggacgat
gttgatcgtgccgtgatgacggcgcatcaggcattaaaaaccagcggctggtcaggttgt
tccccccgtgaacgcggtcgggttttgcgccgctgggcggacttaatcgaacaggatctg
ctgctggcccagcttgaagcacttggctcaacgcgtccgatcgccgacgtggtgcagcat
gaaattcccttcaccgccgaagccattcgtttctatgccgaatgtgctgacaaatacagc
ggtgacctgtttcccacgcgggatagcagcctgggaatgctgattgccgaaccctatggc
gtgatcggggcgattacgccctggaatttccccctgtcgatggcctcgtggaaatgcggg
ccggccctggcggcaggaaatgcggtggtgctgaaaccctctgaactcacgccgctttct
accgtgcgcatggcagagctggcggttcaggctggtttacccgctggcatccttaatatc
gtgcagggcagcggggcggtaacgggcagcgcgctcgtcagacatccgcaagtgcgcaaa
gtgtctttcaccggttccaccctgaccggcgcgcgcatcatgagcgatgccgcacagttt
ggcatgaagcccgttacgctggagctgggcggtaaaagcccccaactggttttcgatgat
gcaggggatattgaggtgctggcgcagcgtattctgcgcggcttcaccgcaaatggcggc
caggcctgcgttgcgggtacgcgcttaatcgtgcagcgcggcattgccgatgcgctgacg
gaacggctggcggcgttatgtcgtgaggccaggccaggcgttacatggcaggacacctcg
cgttatgcaccgctgattgatgcgcgccagggcaataaagtgcgttcggtcattgaagat
gccaaagcgcagggcgctgaggtgctggtaggcggcgaacgcttcgcggacaccgatgag
ggctggttctggcaacccacgctgttaagccaggtgaagcaggataatccggcggtacag
caggaaatttttggtccggtactgaccattcaaaccttcgacgatgaagagcaggggctg
gcgctggcagcacatgatacgtacggcctgtgtgccggtgtgcatacgctgagcctgcca
cgggccatgcgggcgatacgggcgattgacgccggtaccgtgtgggtcaatcgctatgga
cgctccggcgatttcatcattccaaccggcggttttctgggctcgggtattggtaaagat
ttgggacgccaggcgttccaggcctgccagcgccagaaaagcgtacttatcgatttttaa

DBGET integrated database retrieval system