KEGG   Pantoea ananatis LMG 20103: PANA_0985Help
Entry
PANA_0985         CDS       T01195                                 

Gene name
adhP
Definition
(GenBank) AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00071  Fatty acid degradation
pam00350  Tyrosine metabolism
pam00625  Chloroalkane and chloroalkene degradation
pam00626  Naphthalene degradation
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0985 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA_0985 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PANA_0985 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA_0985 (adhP)
   00626 Naphthalene degradation
    PANA_0985 (adhP)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PANA_0985 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADD76152
UniProt: D4GLA6
Position
1135684..1136724
Genome map
AA seq 346 aa AA seqDB search
MTMKINTMMKAAVVKAFGEPLVIEQVPVPQPGSGQILVKIAATGVCHTDLHAAEGDWPVK
PVPPFIPGHEGVGQVVAVGDNVHHLKVGDRVGVPWLYSACGHCEHCLDNWETLCHSQRNT
GYSVNGSFAEYCVADANYVGIIPENLAFNEVAPVLCAGVTVYKGLKMTDTKPGDWVVISG
IGGLGHMAIQYAVAMGLNVAAVDIDDDKLAFAQRLGASVVANARNVDPARVFHEHFGGAH
GVLVTAVSPKAFEQAIGTLRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRKDL
QEALDFASRHKVKASVAVEPLSNINDIFARMHAGKIEGRIVVDMSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaaaatcaacacgatgatgaaggcagcagttgttaaagcgttcggcgaaccc
ttggtgattgagcaggtgcccgtaccccagcctgggtcggggcagattctggtaaaaatc
gcggcaaccggcgtgtgtcacaccgatctgcatgcggcagagggcgactggccggtgaag
ccggttccgccttttatcccgggacatgagggcgtcgggcaggtggtcgcggtgggcgat
aacgtacatcacctgaaggtgggcgatcgggtcggcgtgccctggctctactccgcctgc
ggtcactgcgagcactgtctcgataactgggaaacgctgtgccacagccagcgaaatacc
ggctattcggttaacggcagttttgccgaatactgcgtggcggacgccaactatgtcggc
atcatccccgaaaacctcgcattcaacgaggtggcaccggtgctctgtgcgggcgtgacg
gtctacaaagggttaaaaatgaccgacactaaacccggtgactgggtggtgatttccggc
ataggtgggttagggcacatggctatacagtatgccgtcgcgatggggctgaacgtggcg
gctgtcgatatcgatgacgataagctggcctttgcccagcgcctgggcgccagcgtggtg
gcgaatgccagaaacgtcgatccggccagggtgtttcatgagcactttggcggcgcgcac
ggcgtgctggtcacggcggtgtcgcctaaagcctttgagcaggcgatcggcacgttacgt
cgtgggggcaccatggtgctaaatggcttgccgcctggcaaattcgatctttctattttc
gatatggtgctggacggcattacggtgcggggttctatcgtcggaacgcgtaaggattta
caggaggcgctggattttgccagccgtcataaagtaaaagccagcgtggcggtggaaccg
ctcagcaatattaacgatatctttgcccggatgcatgcgggcaagatagaaggccgtatt
gtggtggatatgtcgttgtaa

DBGET integrated database retrieval system