KEGG   Pantoea ananatis LMG 20103: PANA_1052Help
Entry
PANA_1052         CDS       T01195                                 

Gene name
purK
Definition
(GenBank) PurK
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pam00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PANA_1052 (purK)
Enzymes [BR:pam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     PANA_1052 (purK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp PurK_C
Motif
Other DBs
NCBI-ProteinID: ADD76219
UniProt: D4GLU9
Position
complement(1204243..1205307)
Genome map
AA seq 354 aa AA seqDB search
MKPVCVLGNGQLGRMLRQAGEPMGIAVHPVGLDADPAALPIAESVITAEIERWPETALTR
ELANHPAFVNRDIFPRLADRLTQKQLLDELNLATAPWQLLADKSEWPAVFSRLGELAIVK
RRTGGYDGRGQWRLRASETATLPDDCYGECIVEQGIHFSGEVSLVGARGHDGSTVFYPLT
HNLHEEGILRTSVAFPQADVEQQQQAEGMLGAILHALDYVGVMAMECFVTPQGLLINELA
PRVHNSGHWTQNGASISQFELHLRAILGLALPQPVVIAPSVMINLIGTDVNSDWLQQPLV
HLHWYDKAVRQGRKVGHLNLTDSDQPRLKAALHALLPLLPAEYASGIRWATDKL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggtttgcgtactgggtaacggtcagcttggccgcatgttgcgccaggcgggc
gagccgatgggcattgccgttcatccagtggggctggatgccgatcccgccgccctgcct
atcgccgaaagcgtgattacggccgaaatcgagcgttggcccgaaaccgctctgacgcgc
gagctggcgaatcatccggcctttgtgaaccgcgatatttttccgcgtctggccgatcgc
ctgacgcaaaagcaactgctggacgagcttaatctggcgactgcgccctggcagttgctg
gcggataaaagcgagtggcctgcggttttctctcggctgggtgaactggcgattgttaaa
cgccgcaccgggggttacgacggtcgcggtcagtggcgtttacgggccagcgaaacggcc
acgttacccgacgactgctatggcgagtgtatcgtcgaacagggcattcacttttcaggt
gaagtgtcgctggtcggcgcgcgcggccacgacggcagcaccgtgttttatcccctgaca
cataatctgcacgaagaaggcattctgcggaccagcgtcgcttttccccaggcagatgtg
gaacagcagcagcaggccgaaggaatgctgggcgcgatccttcacgcgcttgactacgtt
ggcgtgatggcgatggaatgttttgtgacgcctcagggtctgttgattaatgagctggcg
ccgcgggtgcataacagtggacactggacgcagaacggcgcctcgattagccagttcgaa
ctgcatctgcgcgcgattttggggctggcgttgccccagccggtcgtcattgcgccctcg
gtcatgatcaacctgattggcaccgatgtgaattcagactggctacagcagccgcttgtc
catctgcactggtatgacaaagcggttcggcaaggtcgcaaggtgggccatctgaacctg
accgacagcgatcagccccgactcaaagctgcactgcatgcgctgttgcccctgctgccg
gctgaatatgccagcggtattcgctgggccacagacaagctttaa

DBGET integrated database retrieval system